[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66460.1
DDBJ      :             putative cytoplasmic protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  56/915 : Eukaryota  0/199 : Viruses  3/175   --->[See Alignment]
d.163.1
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->104 1z1bB PDBj 3e-18 37.4 %
:RPS:PDB   1->107 1ae9B PDBj 2e-06 33.3 %
:RPS:SCOP  48->117 1a0pA2  d.163.1.1 * 7e-06 14.7 %
:HMM:PFM   38->114 PF00589 * Phage_integrase 6e-10 29.0 69/173  
:BLT:SWISS 2->114 VINT_BPHK0 6e-22 41.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66460.1 GT:GENE ACF66460.1 GT:PRODUCT putative cytoplasmic protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2005642..2006010 GB:FROM 2005642 GB:TO 2006010 GB:DIRECTION + GB:PRODUCT putative cytoplasmic protein GB:PROTEIN_ID ACF66460.1 GB:DB_XREF GI:194406241 LENGTH 122 SQ:AASEQ MKIALPLSLNLPSMGLRLSTVIERCRLVSRSEYLISAGIRKNSPNGSIHPNSLTKKFVAARKLTGINFSENPPPFHEIRSLSGRLYKDAYGEGFAQKLLGHTSENTTKLYLDERDNKAYVML GT:EXON 1|1-122:0| BL:SWS:NREP 1 BL:SWS:REP 2->114|VINT_BPHK0|6e-22|41.7|108/357| BL:PDB:NREP 1 BL:PDB:REP 1->104|1z1bB|3e-18|37.4|99/349| RP:PDB:NREP 1 RP:PDB:REP 1->107|1ae9B|2e-06|33.3|102/164| HM:PFM:NREP 1 HM:PFM:REP 38->114|PF00589|6e-10|29.0|69/173|Phage_integrase| RP:SCP:NREP 1 RP:SCP:REP 48->117|1a0pA2|7e-06|14.7|68/180|d.163.1.1| OP:NHOMO 111 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------1-----1------1------------------------------------------------------------------------------------------------------------------------------------------------22-145212123--61---41112623---1---21----34-11212221312-231-2121222----------1--------------------------------------------------1-----1-----1----------1--------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------111----------------------------- STR:NPRED 122 STR:RPRED 100.0 SQ:SECSTR cEEEEETTcEETTTTEEHHHHHHHHHHHTcccccccETTTTcTTcccccHHHHHHHHHHHHHHTTcccccccccTTHHHHHHHHHHHHHTcHHHHHHHHTcccEEcccEEEEccGGGHHHHH DISOP:02AL 1-1,37-51,116-116| PSIPRED cEEEEccccccHHHcccHHHHHHHHHHHHccccEEEcccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHcccccccEEcc //