[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66473.1
DDBJ      :             putative hemolysin
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  81/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   31->75 PF03891 * DUF333 8e-08 53.3 %
:HMM:PFM   30->78 PF03891 * DUF333 2.2e-24 44.9 49/50  
:HMM:PFM   8->36 PF06085 * Rz1 0.00017 40.0 25/59  
:BLT:SWISS 1->83 YOAF_SHIFL 3e-29 63.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66473.1 GT:GENE ACF66473.1 GT:PRODUCT putative hemolysin GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1358865..1359116 GB:FROM 1358865 GB:TO 1359116 GB:DIRECTION + GB:PRODUCT putative hemolysin GB:NOTE identified by match to protein family HMM PF03891 GB:PROTEIN_ID ACF66473.1 GB:DB_XREF GI:194406254 LENGTH 83 SQ:AASEQ MKFTWIALPGVLLLSACSSSQPNAPRPPRIGMPNPAAVYCEQQGGTLMPVQTPQGVRSDCKLPNGEIIDEWTLWRREHPDTKK GT:EXON 1|1-83:0| BL:SWS:NREP 1 BL:SWS:REP 1->83|YOAF_SHIFL|3e-29|63.9|83/84| RP:PFM:NREP 1 RP:PFM:REP 31->75|PF03891|8e-08|53.3|45/50|DUF333| HM:PFM:NREP 2 HM:PFM:REP 30->78|PF03891|2.2e-24|44.9|49/50|DUF333| HM:PFM:REP 8->36|PF06085|0.00017|40.0|25/59|Rz1| OP:NHOMO 81 OP:NHOMOORG 81 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111---1--------------------------------------------------1-------------------------------1------------1--------------------------------------------------------------------------------------1-----111--11--1--------------1---11-1111111-11-1111111111111111111111-----1111111111111111111111-1-----------------------------------------------11111------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,22-29,76-76,78-84| PSIPRED ccHHHHHHHHHHHHHHcccccccccccHHHccccHHHHHHHHHccEEEEEEcccccEEEEEcccccEEHHHHHHHHHcHHccc //