[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66477.1
DDBJ      :             phage minor tail protein U
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
d.323.1
:133 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->131 1z1zA PDBj 7e-40 54.7 %
:RPS:SCOP  3->131 1z1zA1  d.323.1.1 * 3e-53 54.7 %
:HMM:SCOP  3->132 1z1zA1 d.323.1.1 * 9e-49 45.0 %
:RPS:PFM   1->131 PF06141 * Phage_tail_U 2e-39 60.3 %
:HMM:PFM   1->133 PF06141 * Phage_tail_U 3.4e-68 64.7 133/133  
:BLT:SWISS 3->133 VMTU_LAMBD 6e-40 54.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66477.1 GT:GENE ACF66477.1 GT:PRODUCT phage minor tail protein U GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1128915..1129316 GB:FROM 1128915 GB:TO 1129316 GB:DIRECTION + GB:PRODUCT phage minor tail protein U GB:NOTE identified by match to protein family HMM PF06141 GB:PROTEIN_ID ACF66477.1 GB:DB_XREF GI:194406258 LENGTH 133 SQ:AASEQ MTRHSAVRQAIIAALKKTDDGSTTFFDGRPVVVEEDELPAVAVYLSDAQYTGTEVDGDIWSAVLHVEVFLKATAPDSALDEQMENRVYPALGSVAGLGDIIRTMSAQGYNYQRDDEMAMWGSADLSYDITYSM GT:EXON 1|1-133:0| BL:SWS:NREP 1 BL:SWS:REP 3->133|VMTU_LAMBD|6e-40|54.6|130/100| BL:PDB:NREP 1 BL:PDB:REP 3->131|1z1zA|7e-40|54.7|128/129| RP:PFM:NREP 1 RP:PFM:REP 1->131|PF06141|2e-39|60.3|131/132|Phage_tail_U| HM:PFM:NREP 1 HM:PFM:REP 1->133|PF06141|3.4e-68|64.7|133/133|Phage_tail_U| RP:SCP:NREP 1 RP:SCP:REP 3->131|1z1zA1|3e-53|54.7|128/129|d.323.1.1| HM:SCP:REP 3->132|1z1zA1|9e-49|45.0|129/0|d.323.1.1|1/1|Phage tail protein-like| OP:NHOMO 82 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------433-312---61-3-22234544111-11----------1-11-21-1-3--1-13-2121--------------------------------1-1------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------- STR:NPRED 131 STR:RPRED 98.5 SQ:SECSTR ##cccHHHHHHHHHHHHHcccccEEEccccccccGGGccEEEEEEcccccccccccccccccEEEEEEEEcTTccHHHHHHHHHHHHHHHHHHcHHHHHHccccccccEEEEccccccccEEEEEEEETTcEc DISOP:02AL 1-4| PSIPRED ccHHHHHHHHHHHHHHHcccccEEEEccccEEEccccccEEEEEEEcccccccccccccEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHEEEEEEEEEEEEc //