[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66481.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:369 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 197->291 MURD_CLOAB 9e-05 30.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66481.1 GT:GENE ACF66481.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1813454..1814563 GB:FROM 1813454 GB:TO 1814563 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF66481.1 GB:DB_XREF GI:194406262 LENGTH 369 SQ:AASEQ MYIIRGDIIHIFEIRADDMYTTIRNTTLAMVACFSYIAHASTHPPLIITRGAGGDASGATVIHDNWRHGTPDLVNLTDIPIDKIRPEKYRCVLIIGQGAIKEMLLANNASAILSGKTVGLYTHLIDQNTLRLLRQLQNKVRFNLFFTRSQITLLKLRNISEYNFLSSKVNNVWGQDSLAIETVAPDRGNIPEKALPLKTTDYVIWLGGNYTTSSGTQRIFTNDQIVVALKPLHNVISPNASIAIMLSPRFFDNSMSKEAKVKRLKAVLNTFSRNRVTFYMSKEMLANLKEFDLPVQLSPSYAELMRMPWASATRHFASVDQYNLFADLIPKVTPFLLEPNDADQALYATDYLNTRRVSLTQNILNHGCD GT:EXON 1|1-369:0| BL:SWS:NREP 1 BL:SWS:REP 197->291|MURD_CLOAB|9e-05|30.5|95/462| SEG 130->137|lrllrqlq| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1111111111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 368-370| PSIPRED cEEEEccEEEEEEEEccccEEHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccEEEEccccccccccEEcccccHHHcccccEEEEEEEccHHHHHHHHcccccEEEcccEEEEEEEHHcHHHHHHHHHHHccEEEEEEEEEcEEEEEEEEccccccHHHHHHHcccccccEEEEEEccccccccccccccccccEEEEEcccEEcccccEEEEcccEEEEEEccHHHHcccccEEEEEEcHHHccccccHHHHHHHHHHHHHHHcccEEEEEEEHHHHHHHHHccccEEEcccHHHHHcccccHHcHHHHccccHHHHHHHHHcccEEEEcccccccEEEEEcccccEEEEHHHHHHHcccc //