[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66482.1
DDBJ      :             putative cytoplasmic protein
Swiss-Prot:YEHS_ECOLI   RecName: Full=Uncharacterized protein yehS;

Homologs  Archaea  0/68 : Bacteria  170/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:155 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->70 PF07308 * DUF1456 3e-15 45.6 %
:RPS:PFM   86->147 PF07308 * DUF1456 6e-15 51.6 %
:HMM:PFM   4->70 PF07308 * DUF1456 9.2e-28 47.8 67/68  
:HMM:PFM   86->150 PF07308 * DUF1456 5.8e-25 36.9 65/68  
:BLT:SWISS 1->155 YEHS_ECOLI 8e-78 90.3 %
:REPEAT 2|3->64|86->147

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66482.1 GT:GENE ACF66482.1 GT:PRODUCT putative cytoplasmic protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2300818..2301285) GB:FROM 2300818 GB:TO 2301285 GB:DIRECTION - GB:PRODUCT putative cytoplasmic protein GB:NOTE identified by match to protein family HMM PF07308 GB:PROTEIN_ID ACF66482.1 GB:DB_XREF GI:194406263 LENGTH 155 SQ:AASEQ MLSNDILRSVRYILKANNTDLARILALGNVDATPEQIAIWLRKEEEEGFQRCPDIVLSSFLNGLIYEKRGKDEAAPALTAERRINNNIVLKKLRIAFSLKTDDILAILTGQLFRVSMPEITAMMRAPDHKNFRECGDQFMRYFLRGLAAREHAAK GT:EXON 1|1-155:0| SW:ID YEHS_ECOLI SW:DE RecName: Full=Uncharacterized protein yehS; SW:GN Name=yehS; OrderedLocusNames=b2124, JW2112; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->155|YEHS_ECOLI|8e-78|90.3|155/100| NREPEAT 1 REPEAT 2|3->64|86->147| RP:PFM:NREP 2 RP:PFM:REP 3->70|PF07308|3e-15|45.6|68/68|DUF1456| RP:PFM:REP 86->147|PF07308|6e-15|51.6|62/68|DUF1456| HM:PFM:NREP 2 HM:PFM:REP 4->70|PF07308|9.2e-28|47.8|67/68|DUF1456| HM:PFM:REP 86->150|PF07308|5.8e-25|36.9|65/68|DUF1456| OP:NHOMO 175 OP:NHOMOORG 172 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------111--1--1------------------------------------------------------------------------------------11111111-121112------111-------------------------------------------------------11-------------------------------------------------1----------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1--------1-1---1-1--------------------------------1--1111--2-1111111111111111111111-------------1----111111111111-111111111111111111111111--1111111111111111111111-11--111111111111--------------1--1---------------------------11111111111111111----------1111-------1111111111111--------------------------------------------------------------- -------------1-----------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,71-80,152-156| PSIPRED ccHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcc //