[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66499.1
DDBJ      :             probable HTH-type transcriptional regulator LeuO
Swiss-Prot:LEUO_SALTY   RecName: Full=Probable HTH-type transcriptional regulator leuO;

Homologs  Archaea  0/68 : Bacteria  306/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:314 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->215 2esnD PDBj 2e-15 31.7 %
:RPS:PDB   11->231 1b9nA PDBj 8e-19 13.6 %
:RPS:SCOP  17->94 2esnA1  a.4.5.37 * 3e-20 47.4 %
:RPS:SCOP  105->312 1utbA  c.94.1.1 * 2e-19 17.3 %
:HMM:SCOP  17->100 2esnA1 a.4.5.37 * 1.4e-19 45.2 %
:HMM:SCOP  105->312 2esnA2 c.94.1.1 * 2.7e-39 28.8 %
:RPS:PFM   24->79 PF00126 * HTH_1 2e-06 42.9 %
:HMM:PFM   24->81 PF00126 * HTH_1 4.2e-21 43.1 58/60  
:HMM:PFM   138->312 PF03466 * LysR_substrate 1.4e-17 20.7 174/209  
:BLT:SWISS 1->314 LEUO_SALTY e-174 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66499.1 GT:GENE ACF66499.1 GT:PRODUCT probable HTH-type transcriptional regulator LeuO GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 129768..130712 GB:FROM 129768 GB:TO 130712 GB:DIRECTION + GB:PRODUCT probable HTH-type transcriptional regulator LeuO GB:NOTE identified by match to protein family HMM PF00126; match to protein family HMM PF03466 GB:PROTEIN_ID ACF66499.1 GB:DB_XREF GI:194406280 LENGTH 314 SQ:AASEQ MPEVKTEKPHLLDMGKPQLRMVDLNLLTVFDAVMQEQNITRAAHTLGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARAFQLFGSVRQALQLVQNELPGSGFEPTSSERVFNLCVCSPLDNILTSQIYNRVEKIAPNIHVVFKASLNQNTEHQLRYQETEFVISYEEFRRPEFTSVPLFKDEMVLVASRKHPRISGPLLEGDVYNEQHAVVSLDRYASFSQPWYDTPDKQSSVAYQGMALISVLNVVSQTHLVAIAPRWLAEEFAESLDLQILPLPLKLNSRTCYLSWHEAAGRDKGHQWMEDLLVSVCKR GT:EXON 1|1-314:0| SW:ID LEUO_SALTY SW:DE RecName: Full=Probable HTH-type transcriptional regulator leuO; SW:GN Name=leuO; OrderedLocusNames=STM0115; SW:KW Activator; Complete proteome; DNA-binding; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->314|LEUO_SALTY|e-174|100.0|314/314| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| SEG 271->282|ldlqilplplkl| BL:PDB:NREP 1 BL:PDB:REP 29->215|2esnD|2e-15|31.7|186/298| RP:PDB:NREP 1 RP:PDB:REP 11->231|1b9nA|8e-19|13.6|214/258| RP:PFM:NREP 1 RP:PFM:REP 24->79|PF00126|2e-06|42.9|56/60|HTH_1| HM:PFM:NREP 2 HM:PFM:REP 24->81|PF00126|4.2e-21|43.1|58/60|HTH_1| HM:PFM:REP 138->312|PF03466|1.4e-17|20.7|174/209|LysR_substrate| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 17->94|2esnA1|3e-20|47.4|78/89|a.4.5.37| RP:SCP:REP 105->312|1utbA|2e-19|17.3|208/214|c.94.1.1| HM:SCP:REP 17->100|2esnA1|1.4e-19|45.2|84/0|a.4.5.37|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 105->312|2esnA2|2.7e-39|28.8|208/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1232 OP:NHOMOORG 308 OP:PATTERN -------------------------------------------------------------------- ----1---------1----------------------13-----1-------122-------1---212--------------------------------------------------------------------11-------3--------------------12------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------211------22631--1-112-----------1-112112-1111-344235844537312111--1-11-3311111111122-1--1-------------------------------25-125324GBEIFHA6666CC6877772AKA86876--6694122155519213----12-----------15-----------1-----------------19-----------------------------76254-528323455416A333263A72C7-------------34124323332322233-3343321333323223222788231224455555545455553511-32321-3111111111111112-----2444-251B111--1---------33333142124-AAA98BBB7C9AA3556----------5BD8444446DH9B1--------1------2-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 313 STR:RPRED 99.7 SQ:SECSTR #TTEEEEEHHcccEEETTEEEEcHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTcccEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccTTcHHHHHHHHTcccTTccEEEEEEEEEEEcccccccccEEEEEcTTcccEEEEEccHHHHHHTTccTTcEEEEEccGGGcEEEccHHHHHTccEEEEEEEEEEEccccEEEEEEEcTTHHTcccEEEEEEccHHHHHHHTccEEEEEGGGccTTTcTTcEEEEccTTccccEEEEEEEETTccccHHHHHHHHHHcTTccH DISOP:02AL 1-5,8-8,102-109| PSIPRED ccccccccccccccccHHHccccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccEEEEcccccccccEEEEEEEccEEEEEccccccccccccHHHHHccccEEEEccccccHHHHHHHHccccccEEEEEccHHHHHHHHHccccHHHHHHHHHHHHHHHccEEEEEcccccccEEEEEEEcccccccHHHHHHHHHHHHHHcc //