[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66505.1
DDBJ      :             molybdopterin-containing oxidoreductase membrane anchor subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:255 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->189 PF04976 * DmsC 5e-09 34.4 %
:HMM:PFM   3->189 PF04976 * DmsC 3.8e-20 31.0 187/276  
:BLT:SWISS 4->147 YNFH_ECOLI 7e-10 34.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66505.1 GT:GENE ACF66505.1 GT:PRODUCT molybdopterin-containing oxidoreductase membrane anchor subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 724968..725735 GB:FROM 724968 GB:TO 725735 GB:DIRECTION + GB:PRODUCT molybdopterin-containing oxidoreductase membrane anchor subunit GB:PROTEIN_ID ACF66505.1 GB:DB_XREF GI:194406286 LENGTH 255 SQ:AASEQ MEKYELPLVFFTVLSQMSVGMALVLTWRTLRGEVEGQRFCWLATGLVLALASIAAILHLAHPDRAYDALINLRHAWLSREILGATLFGAAVGVTFLAKGHKAMALIASVFGVLLVAVQGMTYAAPAMVAIANGFTMLLFFITVWVMGCAAIPLLKLRPAVPALRQGIVVCIAVLIAAPLVWLSGGTVMQMTARSWLASPFYLASLVCLALAFVASRHGDSRPKLLFVLLFVGVFLSRLVFFGDTVSTIVNIGHLY GT:EXON 1|1-255:0| BL:SWS:NREP 1 BL:SWS:REP 4->147|YNFH_ECOLI|7e-10|34.5|139/284| TM:NTM 8 TM:REGION 6->28| TM:REGION 38->60| TM:REGION 74->96| TM:REGION 100->122| TM:REGION 129->151| TM:REGION 163->185| TM:REGION 194->215| TM:REGION 226->248| SEG 46->61|lvlalasiaailhlah| SEG 224->241|llfvllfvgvflsrlvff| RP:PFM:NREP 1 RP:PFM:REP 4->189|PF04976|5e-09|34.4|183/272|DmsC| HM:PFM:NREP 1 HM:PFM:REP 3->189|PF04976|3.8e-20|31.0|187/276|DmsC| GO:PFM:NREP 2 GO:PFM GO:0016021|"GO:integral to membrane"|PF04976|IPR007059| GO:PFM GO:0019645|"GO:anaerobic electron transport chain"|PF04976|IPR007059| OP:NHOMO 21 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------1-------------------------------------------------------------------------------------------------------------------------------------1111111112112111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHccc //