[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66509.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:51 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66509.1 GT:GENE ACF66509.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1354661..1354816) GB:FROM 1354661 GB:TO 1354816 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF66509.1 GB:DB_XREF GI:194406290 LENGTH 51 SQ:AASEQ MLIRLNWSEKKEQAVDSAESSPSFKVYKIYNKSHKCDAHHVFMIFYYSFMI GT:EXON 1|1-51:0| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1----1--1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 6-22| PSIPRED cEEEEEcHHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHHHHHHHc //