[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66540.1
DDBJ      :             N-acetylmuramoyl-L-alanine amidase AmiD
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  385/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.20.1d.118.1
:276 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->276 3d2yA PDBj e-128 83.3 %
:RPS:PDB   20->276 3d2yA PDBj 3e-88 83.3 %
:RPS:SCOP  22->194 2bgxA2  d.118.1.1 * 7e-42 83.2 %
:RPS:SCOP  195->275 2bgxA1  a.20.1.1 * 1e-10 82.7 %
:HMM:SCOP  22->194 2bgxA2 d.118.1.1 * 7.9e-53 45.7 %
:HMM:SCOP  195->275 2bgxA1 a.20.1.1 * 9.1e-22 43.2 %
:RPS:PFM   44->179 PF01510 * Amidase_2 3e-23 51.7 %
:HMM:PFM   41->179 PF01510 * Amidase_2 1.2e-28 42.0 119/130  
:BLT:SWISS 16->276 AMID_ECOLI e-129 83.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66540.1 GT:GENE ACF66540.1 GT:PRODUCT N-acetylmuramoyl-L-alanine amidase AmiD GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1010240..1011070 GB:FROM 1010240 GB:TO 1011070 GB:DIRECTION + GB:PRODUCT N-acetylmuramoyl-L-alanine amidase AmiD GB:NOTE identified by match to protein family HMM PF01510 GB:PROTEIN_ID ACF66540.1 GB:DB_XREF GI:194406321 LENGTH 276 SQ:AASEQ MKALLWLVGLALLLTGCASEKGIIDKEGYQLDTRHRAQAAYPRIKVLVIHYTAENFDVSLATLTGRNVSSHYLIPATPPLYGGKPRIWQLVPEQDQAWHAGVSFWRGATRLNDTSIGIELENRGWRMSGGVKSFAPFESAQIQALIPLAKDIIARYNIKPQNVVAHADIAPQRKDDPGPRFPWRELAAQGIGAWPDAQRVAFYLAGRAPYTPVDTATVLALLSRYGYEVKADMTAREQQRVIMAFQMHFRPAQWNGIADAETQAIAEALLEKYGQD GT:EXON 1|1-276:0| BL:SWS:NREP 1 BL:SWS:REP 16->276|AMID_ECOLI|e-129|83.1|261/276| TM:NTM 1 TM:REGION 2->24| SEG 4->14|llwlvglalll| BL:PDB:NREP 1 BL:PDB:REP 20->276|3d2yA|e-128|83.3|257/257| RP:PDB:NREP 1 RP:PDB:REP 20->276|3d2yA|3e-88|83.3|257/257| RP:PFM:NREP 1 RP:PFM:REP 44->179|PF01510|3e-23|51.7|116/129|Amidase_2| HM:PFM:NREP 1 HM:PFM:REP 41->179|PF01510|1.2e-28|42.0|119/130|Amidase_2| GO:PFM:NREP 2 GO:PFM GO:0008745|"GO:N-acetylmuramoyl-L-alanine amidase activity"|PF01510|IPR002502| GO:PFM GO:0009253|"GO:peptidoglycan catabolic process"|PF01510|IPR002502| RP:SCP:NREP 2 RP:SCP:REP 22->194|2bgxA2|7e-42|83.2|173/173|d.118.1.1| RP:SCP:REP 195->275|2bgxA1|1e-10|82.7|81/81|a.20.1.1| HM:SCP:REP 22->194|2bgxA2|7.9e-53|45.7|173/0|d.118.1.1|1/1|N-acetylmuramoyl-L-alanine amidase-like| HM:SCP:REP 195->275|2bgxA1|9.1e-22|43.2|81/0|a.20.1.1|1/1|PGBD-like| OP:NHOMO 559 OP:NHOMOORG 387 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------1--1-1---1---1------------------------1-11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1--------------11---111121111111111121111111111111111-11111111111-111111111111111111111111111--------1---1111----------1111--11111-11-1-1-11111-222222222222333322123333132221111111121-1111111111111111311111111111121----------------------------1----------------------------112212111121111111111---11111121---1112------22224232222222222-2222222222222222222222221122322222222222222222222223-233333333333--2111111----1112-111111111111111111111112221334322232222222221111111111211111111111111111111111----1--1------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 262 STR:RPRED 94.9 SQ:SECSTR ##############ccccGcTTEEEccccEEEcccccccccccccEEEEEEccccHHHHHHHHTcccccccEEEcccccEETTEEccEEcccTTcccccccccEETTEEcGGGGEEEEEEccccEEEETTEEEEccccHHHHHHHHHHHHHHHHHHTccGGGEEEHHHHcTTTccTTcTTccHHHHHHTTccccccHHHHHHHHTTccTTccccHHHHHHHHHHHTccccccccHHHHHHHHHHHHHHHcTTcccccccHHHHHHHHHHHHHHccc DISOP:02AL 1-1,275-277| PSIPRED cHHHHHHHHHHHHHccccccHHHccccccccccccccccccccccEEEEEcccccHHHHHHHHHccccEEEEEEcccccccccccEEEEEccHHHHHHHccccccccccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHEEEcHHccccccccccccccHHHHHHccccccccccccHHHHHcccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccc //