[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66553.1
DDBJ      :             glutathione S-transferase domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  102/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
a.45.1c.47.1
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->211 3bbyA PDBj 1e-80 83.0 %
:RPS:PDB   15->207 1byeA PDBj 6e-17 17.9 %
:RPS:SCOP  15->117 1z9hA2  c.47.1.5 * 5e-15 13.7 %
:RPS:SCOP  91->212 1iyhA1  a.45.1.1 * 1e-08 12.7 %
:HMM:SCOP  8->99 1jlwA2 c.47.1.5 * 1.5e-15 34.8 %
:HMM:SCOP  91->215 1fw1A1 a.45.1.1 * 1.5e-10 28.1 %
:RPS:PFM   24->79 PF02798 * GST_N 1e-06 44.6 %
:HMM:PFM   21->81 PF02798 * GST_N 4.5e-14 36.7 60/75  
:BLT:SWISS 1->214 YFCF_ECOLI 4e-99 80.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66553.1 GT:GENE ACF66553.1 GT:PRODUCT glutathione S-transferase domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2504398..2505042) GB:FROM 2504398 GB:TO 2505042 GB:DIRECTION - GB:PRODUCT glutathione S-transferase domain protein GB:NOTE identified by match to protein family HMM PF02798 GB:PROTEIN_ID ACF66553.1 GB:DB_XREF GI:194406334 LENGTH 214 SQ:AASEQ MSKPVIVLWSDANFFSPYVLSAWVALQEKGLSFTLKTRDLDQGEHLQPGWRGYALTQRVPVLEADNFELSESSAIAEYLEERFAPPQWERIYPHDLQKRARARQIQAWLRSDLLPLREERPTDVVFAGAKKAPLSEAGKASAAKLFATAEALLGQGTQNLFGEWCIADTDLALMINRLALHGDDVPASLAAYATFQWQRASVQRFIALSSKRSG GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 1->214|YFCF_ECOLI|4e-99|80.8|214/214| BL:PDB:NREP 1 BL:PDB:REP 3->211|3bbyA|1e-80|83.0|188/188| RP:PDB:NREP 1 RP:PDB:REP 15->207|1byeA|6e-17|17.9|190/213| RP:PFM:NREP 1 RP:PFM:REP 24->79|PF02798|1e-06|44.6|56/71|GST_N| HM:PFM:NREP 1 HM:PFM:REP 21->81|PF02798|4.5e-14|36.7|60/75|GST_N| RP:SCP:NREP 2 RP:SCP:REP 15->117|1z9hA2|5e-15|13.7|102/113|c.47.1.5| RP:SCP:REP 91->212|1iyhA1|1e-08|12.7|118/124|a.45.1.1| HM:SCP:REP 8->99|1jlwA2|1.5e-15|34.8|89/90|c.47.1.5|1/1|Thioredoxin-like| HM:SCP:REP 91->215|1fw1A1|1.5e-10|28.1|121/125|a.45.1.1|1/1|Glutathione S-transferase (GST), C-terminal domain| OP:NHOMO 121 OP:NHOMOORG 114 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------1---11111------1------1-------1---1----1-1-1---111--1--1----1-----------1--------------------------1111-------------------------------------------11-----1-----------------------11--1111111111111-1111111111111111111111-----111111111111111111121111--1--------------------------1-----------------11111-------22-2-111---------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------1-141-111-1------------1------1-11-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 212 STR:RPRED 99.1 SQ:SECSTR ccccEEEEEEcccHccccHHHHHHHHHHTTccEEcccccGGGTGGGcTTGGGTccccccccEEETTEEcccHHHHHHHHHHHHcGGGTcTTTTTcHHHHHHHHHHHHHHHHHTHHHHHHHHHHHTHHHHHcccccHHHHHHHHHHHHHHHHHTTcccccccccccHHHHTTHHHHHHHHHcTTTTGGGHHHHHHHHTTcHHHHHHHHcTTcc## DISOP:02AL 1-3,210-211,213-215| PSIPRED cccccEEEEEcccccccHHHHHHHHHHHcccccEEEEccccccccccHHHHHccccccccEEEEccEEEEEHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHccc //