[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66566.1
DDBJ      :             L-lactate oxidase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  421/915 : Eukaryota  181/199 : Viruses  0/175   --->[See Alignment]
c.1.4
:400 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->388 2j6xC PDBj 3e-88 47.3 %
:RPS:PDB   26->398 2e77B PDBj 1e-53 45.8 %
:RPS:SCOP  36->397 1al7A  c.1.4.1 * 1e-45 36.0 %
:HMM:SCOP  37->395 1huvA_ c.1.4.1 * 6.1e-101 39.4 %
:RPS:PFM   51->387 PF01070 * FMN_dh 1e-70 47.3 %
:HMM:PFM   49->390 PF01070 * FMN_dh 7.3e-116 46.0 339/355  
:BLT:SWISS 36->400 GOX1_ARATH 3e-63 41.6 %
:PROS 290->296|PS00557|FMN_HYDROXY_ACID_DH_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66566.1 GT:GENE ACF66566.1 GT:PRODUCT L-lactate oxidase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1755935..1757137) GB:FROM 1755935 GB:TO 1757137 GB:DIRECTION - GB:PRODUCT L-lactate oxidase GB:NOTE identified by match to protein family HMM PF01070; match to protein family HMM PF01180 GB:PROTEIN_ID ACF66566.1 GB:DB_XREF GI:194406347 LENGTH 400 SQ:AASEQ MKTHHLIRVVALLAMLATSGLAYAEEYKASTDEKAIKMTNVASLEARVQARMEKGAFGYIRGGAEDENNLRSNTESFDKKYIMPRVLQGIELKEIDLSTQLLGIPLKTPIIQAPMAAQGLAHASGELATAKGMAQVGSIFSLSTYGNKTIEEVANVSGKNPFFFQLYMSKNNQFNEFILAQAVKHGAKAIILTVDSPVGGYREEDIKNNFQFPLGFANLEMFARKNDDGSKTGKGAGISEIYAQAKQAFTPEDIAYVHRISGLPVIVKGIQSPEDAEIAIQAGAAGIWVSNHGGRQLDSGPSSFDMLPAIAKVVNKRVPVIFDSGVRRGSHVFKALASGADIVAVGRPVLYGLNLGGAQGVASVIEQLNKELTINMMLGGARNIEQVKTTRLLTEKDLPQ GT:EXON 1|1-400:0| BL:SWS:NREP 1 BL:SWS:REP 36->400|GOX1_ARATH|3e-63|41.6|356/367| PROS 290->296|PS00557|FMN_HYDROXY_ACID_DH_1|PDOC00482| TM:NTM 1 TM:REGION 2->23| SEG 276->287|aeiaiqagaagi| BL:PDB:NREP 1 BL:PDB:REP 26->388|2j6xC|3e-88|47.3|355/368| RP:PDB:NREP 1 RP:PDB:REP 26->398|2e77B|1e-53|45.8|365/368| RP:PFM:NREP 1 RP:PFM:REP 51->387|PF01070|1e-70|47.3|319/328|FMN_dh| HM:PFM:NREP 1 HM:PFM:REP 49->390|PF01070|7.3e-116|46.0|339/355|FMN_dh| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01070|IPR000262| RP:SCP:NREP 1 RP:SCP:REP 36->397|1al7A|1e-45|36.0|350/350|c.1.4.1| HM:SCP:REP 37->395|1huvA_|6.1e-101|39.4|353/0|c.1.4.1|1/1|FMN-linked oxidoreductases| OP:NHOMO 1344 OP:NHOMOORG 606 OP:PATTERN -----------------------1----1--1-----------------------------1------ --3141-111111-24422-22113322222222224252-3232111----1111-1--212-31512-1-----------3-----------------1---1---------------------------------------21-1-------------------1112--11-----11-1211----1-----------------------------1---------1-------------------------12--1-111--223-1---1-----1------11111-111111111111111111-----------11--1111111-1-12---1112------1---------12--------11-1221-11111-3221111111111111111111---1--1-3232-333333133335412212351111323---------111-1-------------------------------11241-23232-1121-3333222133333-3--51331-1---1223363212211---1---111111111--3---2-1111-11111----1----------1--1-1----------------------------1-1-1----------------------------------11---1-1111122111-111111111111111111122211121211222122122222211111111---11111111111---------------122111-1-11111---111111111131122221--221111---1212222221-----11111-11--1111111111-------1111111------------------------------------------------- ----11------1119C87A876EDFC44344433334343444445567ADOG77633444233-23211241221-1121111211-7F5C3736562413112-1--L222223222221222232473-22322222226122212222422223232-5121223132721112H1211154A77722242216 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 378 STR:RPRED 94.5 SQ:SECSTR ######################HccccccccccccccccccTHHHHHHHTTccHHHHHHHHcccTTcHHHHHHHHGGGGEEEccccccccccccccccEEETTEEEcccEEEcccccGGGTcTTHHHHHHHHHHHHTccEEEETTccccHHHHHHHHTTccEEEEEcccccHHHHHHHHHHHHHHTcccEEEEcccccccccHHHHHTTcccccccTTTcccTTTGGGTTccGGGccHHHHHHHccccccHHHHHHHHHHHcccEEEEEEccHHHHHHHHHTTccEEEEccGGGTcccccccHHHHHHHHHHHHTTcccEEEccccccHHHHHHHHHTTccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccHHHHTTccEEEccccTT DISOP:02AL 1-3,19-36,395-401| PSIPRED ccHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccEEEEccEEEcccEEEcHHHHHHHccHHHHHHHHHHHHHccccEEEcccccccHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHcccccccccccHHHHcccccccccccccHHHHHHHHHHcccccHHHHHHHHHHccccEEEEccccHHHHHHHHHccccEEEEcccccccccccccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHcccccEEEcccccc //