[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66575.1
DDBJ      :             aldose 1-epimerase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  237/915 : Eukaryota  125/199 : Viruses  0/175   --->[See Alignment]
b.30.5
:294 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->294 2htbC PDBj e-177 100.0 %
:RPS:PDB   20->289 2cirA PDBj 4e-42 27.0 %
:RPS:SCOP  10->269 1jovA  b.30.5.7 * 1e-62 35.9 %
:HMM:SCOP  6->268 1jovA_ b.30.5.7 * 9.4e-64 41.1 %
:RPS:PFM   93->169 PF01263 * Aldose_epim 5e-06 42.5 %
:HMM:PFM   27->274 PF01263 * Aldose_epim 2.2e-45 23.3 240/301  
:BLT:SWISS 1->294 YEAD_ECOLI e-149 82.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66575.1 GT:GENE ACF66575.1 GT:PRODUCT aldose 1-epimerase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1372519..1373403) GB:FROM 1372519 GB:TO 1373403 GB:DIRECTION - GB:PRODUCT aldose 1-epimerase GB:NOTE identified by match to protein family HMM PF01263 GB:PROTEIN_ID ACF66575.1 GB:DB_XREF GI:194406356 LENGTH 294 SQ:AASEQ MINKIFALPVIEQLTPVLSRRQLDDLDLIVVDHPQVKASFALQGAHLLSWKPVGEEEVLWLSNNTPFKTGVALRGGVPICWPWFGPAAQQGLPSHGFARNLPWALKAHNEDDNGVMLTFELQSSEATRKYWPHDFTLLARFKVGKTCEIELEAHGEFATTSALHSYFNVGDIANVKVSGLGDRFIDKVNDAKEGVLTDGIQTFPDRTDRVYLNPEACSVIHDATLNRTIDVVHHHHLNVVGWNPGPALSVSMGDMPDDGYKTFVCVETVYATAPQQATEEKPSRLAQTICVAKR GT:EXON 1|1-294:0| BL:SWS:NREP 1 BL:SWS:REP 1->294|YEAD_ECOLI|e-149|82.7|294/294| BL:PDB:NREP 1 BL:PDB:REP 1->294|2htbC|e-177|100.0|294/295| RP:PDB:NREP 1 RP:PDB:REP 20->289|2cirA|4e-42|27.0|267/287| RP:PFM:NREP 1 RP:PFM:REP 93->169|PF01263|5e-06|42.5|73/295|Aldose_epim| HM:PFM:NREP 1 HM:PFM:REP 27->274|PF01263|2.2e-45|23.3|240/301|Aldose_epim| GO:PFM:NREP 2 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01263|IPR008183| GO:PFM GO:0016853|"GO:isomerase activity"|PF01263|IPR008183| RP:SCP:NREP 1 RP:SCP:REP 10->269|1jovA|1e-62|35.9|245/269|b.30.5.7| HM:SCP:REP 6->268|1jovA_|9.4e-64|41.1|248/269|b.30.5.7|1/1|Galactose mutarotase-like| OP:NHOMO 473 OP:NHOMOORG 362 OP:PATTERN -------------------------------------------------------------------- 1-1---11111-----------------------------------111------1-------------------111--------------------------------------------------------------------1-1---1--11111-111---111--1111111-111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-------------111-1111-1----11111--------111111----------------------------------------------------1------1111111-1111111111111111111111------1------11111111111111111-1111111111111111111111111-111111111111-1-11111111111-111111111111--------------11-1111111-11111--2------1--11122222222222221222---------11111111111111111111111111111----------------------------------------------------------1 ----112-211-11111111111111111-11111111111111111111111111111---111111-11111111111111111---1-1111-111-1-1111-14-4--------------------------------------------------1-1111112---112243M3221245681822258663 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 294 STR:RPRED 100.0 SQ:SECSTR HHHHHHHccccEEccccEEEEcccEEEEEETTEEEEEEEEETcTTEEEEEEETTEEccccccTTccccccccccccccEEccccccccccTccTTccGGGcccEEEEEEEETTTEEEEEEEcGGHHHHHHcccccEEEEEEEEcccEEEEEEEEccEEEEEEEccEEEcccGGGEEEEccTcEEEETTTTEEEEEcccccccccccEEEEEccccTTccEEEEETTEEEEEEEEEccEEEEEEcHHHHHHHcTTccTTGGGGEEEEEEEEEEEEEEEcTTcEEEEEEEcEEEEc DISOP:02AL 1-2,293-295| PSIPRED cccEEEEEEEEEEEccEEEEEEEccEEEEEEEcccEEEEEEccccEEEEEEEccccEEEEcccHHHccccccEEccccEEEEEEccccccccccccccccccEEEEEEccccccEEEEEEEcccHHHHccccEEEEEEEEEEEcccEEEEEcccccEEEEEEEccccccccccEEEEEccccccEEEcccccccEEccccEEEcccEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEccHHHccccccccccccccEEEEEccccccccccccccccEEEEEEEEEEcc //