[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66579.1
DDBJ      :             4Fe-4S binding domain protein
Swiss-Prot:PHSB_SALTY   RecName: Full=Thiosulfate reductase electron transport protein phsB;

Homologs  Archaea  55/68 : Bacteria  526/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:192 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->155 1kqfB PDBj 6e-29 41.7 %
:RPS:PDB   64->162 1a6lA PDBj 3e-11 18.6 %
:RPS:SCOP  7->169 1ti2B2  d.58.1.5 * 2e-44 28.4 %
:HMM:SCOP  7->154 1q16B_ d.58.1.5 * 1.4e-61 49.7 %
:HMM:PFM   12->28 PF00037 * Fer4 1.3e-06 52.9 17/24  
:HMM:PFM   72->80 PF00037 * Fer4 0.0003 77.8 9/24  
:HMM:PFM   89->110 PF00037 * Fer4 2.7e-10 45.5 22/24  
:HMM:PFM   138->149 PF00037 * Fer4 1.7e-05 58.3 12/24  
:BLT:SWISS 1->192 PHSB_SALTY e-115 99.5 %
:PROS 96->107|PS00198|4FE4S_FER_1
:REPEAT 3|13->51|58->88|90->119

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66579.1 GT:GENE ACF66579.1 GT:PRODUCT 4Fe-4S binding domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2185701..2186279) GB:FROM 2185701 GB:TO 2186279 GB:DIRECTION - GB:PRODUCT 4Fe-4S binding domain protein GB:NOTE identified by match to protein family HMM PF00037 GB:PROTEIN_ID ACF66579.1 GB:DB_XREF GI:194406360 LENGTH 192 SQ:AASEQ MNHLTNQYVMLHDEKRCIGCQACTVACKVLNDVPEGFSRVQVQIRAPEQASNALTHFQFVRVSCQHCENAPCVSVCPTGASYRDENGIVQVDKSRCIGCDYCVAACPFHVRYLNPQTGVADKCNFCVDTRLAAGQSPACVSVCPTDALKFGRLDESEIQRWVGQKEVYRQQEARSGAVSLYRRKEVHQEGKA GT:EXON 1|1-192:0| SW:ID PHSB_SALTY SW:DE RecName: Full=Thiosulfate reductase electron transport protein phsB; SW:GN Name=phsB; OrderedLocusNames=STM2064; SW:KW 4Fe-4S; Complete proteome; Electron transport; Iron; Iron-sulfur;Metal-binding; Repeat; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->192|PHSB_SALTY|e-115|99.5|192/192| GO:SWS:NREP 5 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 96->107|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 3|13->51|58->88|90->119| BL:PDB:NREP 1 BL:PDB:REP 11->155|1kqfB|6e-29|41.7|144/289| RP:PDB:NREP 1 RP:PDB:REP 64->162|1a6lA|3e-11|18.6|97/106| HM:PFM:NREP 4 HM:PFM:REP 12->28|PF00037|1.3e-06|52.9|17/24|Fer4| HM:PFM:REP 72->80|PF00037|0.0003|77.8|9/24|Fer4| HM:PFM:REP 89->110|PF00037|2.7e-10|45.5|22/24|Fer4| HM:PFM:REP 138->149|PF00037|1.7e-05|58.3|12/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 7->169|1ti2B2|2e-44|28.4|162/195|d.58.1.5| HM:SCP:REP 7->154|1q16B_|1.4e-61|49.7|145/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 2562 OP:NHOMOORG 584 OP:PATTERN 22121322344333325-5574473113-1131-433333333-1--13-21232115262---4--- -7911111111--1-2211-11--1211111-12221-111---11211-----11----2122112-31---------7dS334322---------1111111111111---------------224333333234442233314----------------------------------------2121---1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1-------------------------------------------------------134-11111111-1-1411-111--1--9--13qm3355-5AB11131--1831--1------21--423-32--11111111112-2242232511----------1-1121-11212-1--31211111111311--8-3-------------------------------111-122-3311212233333324444413222334211232241443325213124-1-23----------B3418E658CC8DBAAF198797693-BABA353827422112211-2-------2B3321174-111-----46997-5H9A9787CA8K8---1842------B5D9AA-HIIGHGFFHH-HHGIHGGHGHIGHFHHHHA9AA9621CHEGGHHHHHHGFHFGG7ACBFEFG--555555555555---1---------1112-444444133232114-------1-12-22221-1--11114-------------2333111114422322------------123-111111-------------------------------------31--11111131 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 85.9 SQ:SECSTR ######HHHHHHccccccHHHHHHHHHHHHHTcTTcTTGGGTTccEEEEcTTcccHHHEcccTGTTTcccHHHHHcTTccEEEccccEEEEcTTTcccccccTTTcTTccEEEGGGccGGGTHHHHHHHHHHHTTcccccccccccTTHHHHTTcccGGGGccGGGHHHHH##################### DISOP:02AL 1-4,183-193| PSIPRED cccccccEEEEEEccccccccHHHHHHHHHHccccccEEEEEEEEccccccccccEEEEEEEccccccccHHHHHccccccEEcccccEEccHHHcccccHHHHccccccEEEcccccEEEEEEccccccccccccccHHHHcccccEEEEEccHHHHHHHHHcccHHHHHHHcccccEEEccccccccccc //