[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66588.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:52 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->31 PF00520 * Ion_trans 0.00056 17.9 28/201  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66588.1 GT:GENE ACF66588.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 357327..357485 GB:FROM 357327 GB:TO 357485 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF66588.1 GB:DB_XREF GI:194406369 LENGTH 52 SQ:AASEQ MNSKYFREVFFVSVVVILLFYLVLFAASAHAEGGFSSGGIGLFMTGTREMLL GT:EXON 1|1-52:0| TM:NTM 2 TM:REGION 7->28| TM:REGION 36->52| SEG 9->25|vffvsvvvillfylvlf| HM:PFM:NREP 1 HM:PFM:REP 4->31|PF00520|0.00056|17.9|28/201|Ion_trans| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcHHHHHc //