[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66593.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:223 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66593.1 GT:GENE ACF66593.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2620362..2621033 GB:FROM 2620362 GB:TO 2621033 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF66593.1 GB:DB_XREF GI:194406374 LENGTH 223 SQ:AASEQ MNARLISAPSLSPEEQKNRLAEFFREYWGTQQINDYHTDTTFHVNHKKQYCDLRWSEKYIDVDYWCSREIHHKEWSKFLIAITTALHTPIPPYYLDFNLKGRRTTLRKRHRRTESKIGCFIYPYKEDPDGGWDYSVDCLMIYESDFEILAAGINKLYPRNHEDKSFDYTSWNEFTLAECEKIISHWLIIARSNGEYASFIQYVIEWIQPLLHQYDSIMIEGNL GT:EXON 1|1-223:0| SEG 102->113|rrttlrkrhrrt| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,6-17| PSIPRED ccccEEccccccHHHHHHHHHHHHHHHHcccccccccccEEEEEccccEEEccccccEEEEHHHHHccHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHccccEEEEEccccccccccEEEEEEEEEcccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHEEEEEccccHHHHHHHHHHHHHHHHHHHcEEEEEccc //