[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66603.1
DDBJ      :             peptidase S1 and S6 chymotrypsin/Hap
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  81/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.47.1
:273 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->86 1p3cA PDBj 1e-05 43.2 %
:RPS:PDB   50->242 3cp7A PDBj 2e-07 18.4 %
:RPS:SCOP  41->263 1p3cA  b.47.1.1 * 4e-28 21.8 %
:HMM:SCOP  13->272 1agjA_ b.47.1.1 * 4.9e-29 24.1 %
:HMM:PFM   49->244 PF00089 * Trypsin 9e-12 23.8 164/219  
:BLT:SWISS 1->272 YDGD_ECOLI e-121 77.9 %
:PROS 80->85|PS00134|TRYPSIN_HIS
:PROS 217->228|PS00135|TRYPSIN_SER
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66603.1 GT:GENE ACF66603.1 GT:PRODUCT peptidase S1 and S6 chymotrypsin/Hap GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1608105..1608926) GB:FROM 1608105 GB:TO 1608926 GB:DIRECTION - GB:PRODUCT peptidase S1 and S6 chymotrypsin/Hap GB:NOTE identified by match to protein family HMM PF00089 GB:PROTEIN_ID ACF66603.1 GB:DB_XREF GI:194406384 LENGTH 273 SQ:AASEQ MHKTIAVLLGIVCFLPVMAKAGGAETDATDASDVKTLFFNHDDRVPVADPTQSPWDAIGQLETASGNLCTATLISPHIALTAGHCLLTPPKGKPDKAVALRFVARKGVWRYEIHGIEGRVEPSLGRRLKADGDGWIVPPAAASWDFGLVILRYPPSGITPVPLFTGDKAALTAALKAADRKVTQSGYPEDHLDALYSHQDCVVTGWAQNAVLSHQCDTLPGDSGSPLLLHTDSGWQLIGVQSSAPAAKDRWRADNRAISVTGFRDKLKALAQD GT:EXON 1|1-273:0| BL:SWS:NREP 1 BL:SWS:REP 1->272|YDGD_ECOLI|e-121|77.9|272/273| PROS 80->85|PS00134|TRYPSIN_HIS|PDOC00124| PROS 217->228|PS00135|TRYPSIN_SER|PDOC00124| TM:NTM 1 TM:REGION 3->24| SEG 168->178|kaaltaalkaa| BL:PDB:NREP 1 BL:PDB:REP 42->86|1p3cA|1e-05|43.2|44/215| RP:PDB:NREP 1 RP:PDB:REP 50->242|3cp7A|2e-07|18.4|179/216| HM:PFM:NREP 1 HM:PFM:REP 49->244|PF00089|9e-12|23.8|164/219|Trypsin| RP:SCP:NREP 1 RP:SCP:REP 41->263|1p3cA|4e-28|21.8|197/215|b.47.1.1| HM:SCP:REP 13->272|1agjA_|4.9e-29|24.1|220/242|b.47.1.1|1/1|Trypsin-like serine proteases| OP:NHOMO 81 OP:NHOMOORG 81 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1------------------------1---------------------1---------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------11111111111111111-111111111111111111111111---11-111111111111111111111--111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 204 STR:RPRED 74.7 SQ:SECSTR #########################################cccEEccccTTcTTEEEEEEEETTEEEEEEEEcTccEEEEcGGGTcccTTccccEEEEEEETccccccTTccEEEEEEEEcHEcccEEcccEEHHHHHccGGGccEEEEEcccTTccHHHHHcccccccccccccccccEEEEEEcccccccccEEEEEEcEEcTTccccEEEEccccTTcTTcEEEEcccccccEEEEccEcc############################ DISOP:02AL 1-1,24-33,35-35,273-274| PSIPRED ccEEHHHHHHHHHHHHHHccccccccccccccccccEEEEccccEEEccccccccEEEEEEEEccccEEEEEEEEccEEEEEEEEEEccccccccccEEEEEEEEccccccccccEEEEEEEccccEEEEEccccccccccccccEEEEEEccccccccEEEEccccccccccccEEcccEEEEEcccccccccEEEcHHHHHcccccccEEEcccccccccccccEEEEEccEEEEEEEEEEcHHHcccccccEEEEEcHHHHHHHHHHHcc //