[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66605.1
DDBJ      :             transcriptional regulator, TetR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:192 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->119 3e7qB PDBj 5e-09 31.1 %
:RPS:PDB   7->186 1bjyB PDBj 9e-14 11.7 %
:RPS:SCOP  9->67 1z77A1  a.4.1.9 * 8e-12 35.6 %
:RPS:SCOP  76->162 2id3A2  a.121.1.1 * 1e-05 10.3 %
:HMM:SCOP  3->70 2gfnA1 a.4.1.9 * 1.5e-12 36.8 %
:HMM:SCOP  77->191 2g3bA2 a.121.1.1 * 1.2e-17 25.7 %
:RPS:PFM   13->51 PF00440 * TetR_N 1e-04 43.6 %
:HMM:PFM   13->51 PF00440 * TetR_N 5.7e-14 48.7 39/47  
:BLT:SWISS 1->150 YBJK_ECOLI 7e-07 30.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66605.1 GT:GENE ACF66605.1 GT:PRODUCT transcriptional regulator, TetR family GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1707263..1707841 GB:FROM 1707263 GB:TO 1707841 GB:DIRECTION + GB:PRODUCT transcriptional regulator, TetR family GB:NOTE identified by match to protein family HMM PF00440 GB:PROTEIN_ID ACF66605.1 GB:DB_XREF GI:194406386 LENGTH 192 SQ:AASEQ MSYLNRDERREVILQAAMRVALAEGFAAMTVRRIASEADVAAGQVHHHFSSAGELKAQAFVHLIRTLLDAGQVPPPATWRARLHAMLGSEDGGFEPYIKLWREAQILADRDPHIRDAYLLTMQMWHEETVTIIEQGKQAGEFTFTANATDIAWRLIALVCGLDGMYVLGIPEMADPAFKYHLDRMITLELFA GT:EXON 1|1-192:0| BL:SWS:NREP 1 BL:SWS:REP 1->150|YBJK_ECOLI|7e-07|30.5|141/178| TM:NTM 1 TM:REGION 149->171| BL:PDB:NREP 1 BL:PDB:REP 2->119|3e7qB|5e-09|31.1|106/210| RP:PDB:NREP 1 RP:PDB:REP 7->186|1bjyB|9e-14|11.7|180/198| RP:PFM:NREP 1 RP:PFM:REP 13->51|PF00440|1e-04|43.6|39/47|TetR_N| HM:PFM:NREP 1 HM:PFM:REP 13->51|PF00440|5.7e-14|48.7|39/47|TetR_N| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 9->67|1z77A1|8e-12|35.6|59/75|a.4.1.9| RP:SCP:REP 76->162|2id3A2|1e-05|10.3|87/123|a.121.1.1| HM:SCP:REP 3->70|2gfnA1|1.5e-12|36.8|68/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 77->191|2g3bA2|1.2e-17|25.7|113/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 37 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- --------------------------------------11-----------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-------------------------------221-----1111111111111111----------1--------------------------------------------1111111----------1--1--------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 189 STR:RPRED 98.4 SQ:SECSTR #ccccHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHcccHHHHHHHHHHHHHHHHcccccccTTccHHHHHHHHHHHHHHccTTHHHHHTTccccGGGHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHTTTTcHHHHHHHHHHHHHHTH## DISOP:02AL 1-8| PSIPRED cccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcc //