[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66629.1
DDBJ      :             outer membrane assembly lipoprotein YfiO
Swiss-Prot:YFIO_ECOLI   RecName: Full=UPF0169 lipoprotein yfiO;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  450/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.118.8
:245 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   32->123 3ee7D PDBj 6e-11 14.1 %
:RPS:SCOP  36->224 1ya0A1  a.118.8.1 * 2e-04 10.8 %
:HMM:SCOP  22->123 2ff4A2 a.118.8.3 * 2e-07 24.2 %
:BLT:SWISS 1->245 YFIO_ECOLI e-137 96.3 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66629.1 GT:GENE ACF66629.1 GT:PRODUCT outer membrane assembly lipoprotein YfiO GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2814856..2815593 GB:FROM 2814856 GB:TO 2815593 GB:DIRECTION + GB:PRODUCT outer membrane assembly lipoprotein YfiO GB:NOTE identified by match to protein family HMM TIGR03302 GB:PROTEIN_ID ACF66629.1 GB:DB_XREF GI:194406410 LENGTH 245 SQ:AASEQ MTRMKYLVAAATLSLFLAGCSGSKEEVPDNPPNEIYATAQQKLQDGNWKQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFMRLNPTHPNIDYVMYMRGLTNMALDDSALQGFFGVDRSDRDPQHARAAFNDFSKLVRSYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTARGAWVAVVNRVEGMLRNYPDTQATRDALPLMENAYRQMQLNAQADKVAKIIAANSKNT GT:EXON 1|1-245:0| SW:ID YFIO_ECOLI SW:DE RecName: Full=UPF0169 lipoprotein yfiO;Flags: Precursor; SW:GN Name=yfiO; OrderedLocusNames=b2595, JW2577; SW:KW Cell membrane; Cell outer membrane; Complete proteome; Lipoprotein;Membrane; Palmitate; Signal. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->245|YFIO_ECOLI|e-137|96.3|245/245| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0009279|"GO:cell outer membrane"|Cell outer membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| TM:NTM 1 TM:REGION 5->27| RP:PDB:NREP 1 RP:PDB:REP 32->123|3ee7D|6e-11|14.1|92/112| RP:SCP:NREP 1 RP:SCP:REP 36->224|1ya0A1|2e-04|10.8|185/458|a.118.8.1| HM:SCP:REP 22->123|2ff4A2|2e-07|24.2|99/0|a.118.8.3|1/1|TPR-like| OP:NHOMO 453 OP:NHOMOORG 452 OP:PATTERN -------------------------------------------------------------------- 111--------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111111111111111111111111111111111-11111111111111111111111111-11-111111-1-11111111111111111111111111--1111-1-1111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-------------------------111111111111111111111111111111111-112111--11111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 92 STR:RPRED 37.6 SQ:SECSTR ###############################cEEEEEEEEccTTTcccccEEEEEEcccccEEEEEEEccccccEEEEEcccccEEEEccccEEEEEccTTccEEEEEEEcTTccHHHHHHHH########################################################################################################################## DISOP:02AL 1-2,243-246| PSIPRED cHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccc //