[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66638.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:257 amino acids
:PSIPRED
:DISOPRED
:TM
:REPEAT 2|61->150|168->256

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66638.1 GT:GENE ACF66638.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 330388..331161 GB:FROM 330388 GB:TO 331161 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF66638.1 GB:DB_XREF GI:194406419 LENGTH 257 SQ:AASEQ MMKKSTYDVSHHSAVCGVTGDYYRISATYHIKRSIRVFLIILCCLLPGGVFAGSLINAGFISPDNVNLSIRDFLGFYASDNLQEKDNTLMYVLGVADATEGKTWCGYGQVDSITINHTVLAWLDRYSVKKPDARASVLIEEALVKNFPCQGTEPSVKIASRSSPVLSLTPDALNLSGNDFFKFWVSGNQRDKLRAGIYLLGVEDATENKLWCGYALFKTLTLNELVYVSLKNKTNEELNSRAAELIINKLIEYPCKI GT:EXON 1|1-257:0| TM:NTM 1 TM:REGION 36->58| NREPEAT 1 REPEAT 2|61->150|168->256| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-11-111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,152-163| PSIPRED cccccccccccccEEEcccccEEEEEEEEEEHHHHHHHHHHHHHHcccHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccEEEccccccEEEEccccEEcccccEEEEEEcccHHHHHHHHHHHHcccccccccccccHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccc //