[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66642.1
DDBJ      :             putative ABC-type transport system
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.43.1
:93 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  8->85 1y9bA1  a.43.1.9 * 1e-14 28.2 %
:HMM:SCOP  7->86 1y9bA1 a.43.1.9 * 1.1e-18 45.0 %
:RPS:PFM   11->81 PF08681 * DUF1778 2e-09 39.4 %
:HMM:PFM   11->88 PF08681 * DUF1778 1.8e-28 47.4 78/80  
:BLT:SWISS 11->81 Y420_HAEIN 6e-07 35.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66642.1 GT:GENE ACF66642.1 GT:PRODUCT putative ABC-type transport system GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 3021856..3022137 GB:FROM 3021856 GB:TO 3022137 GB:DIRECTION + GB:PRODUCT putative ABC-type transport system GB:NOTE identified by match to protein family HMM PF08681 GB:PROTEIN_ID ACF66642.1 GB:DB_XREF GI:194406423 LENGTH 93 SQ:AASEQ MPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAPNEKLLAAAFALPDMKK GT:EXON 1|1-93:0| BL:SWS:NREP 1 BL:SWS:REP 11->81|Y420_HAEIN|6e-07|35.2|71/99| RP:PFM:NREP 1 RP:PFM:REP 11->81|PF08681|2e-09|39.4|71/79|DUF1778| HM:PFM:NREP 1 HM:PFM:REP 11->88|PF08681|1.8e-28|47.4|78/80|DUF1778| RP:SCP:NREP 1 RP:SCP:REP 8->85|1y9bA1|1e-14|28.2|78/81|a.43.1.9| HM:SCP:REP 7->86|1y9bA1|1.1e-18|45.0|80/0|a.43.1.9|1/1|Ribbon-helix-helix| OP:NHOMO 36 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------1--1------------------------------1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------1------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------11-----1--1----1-1--1-------------1111-111-1111211112---------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,91-94| PSIPRED ccccccccccHHHEEccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccHHHHHHHHHHHHHcc //