[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66655.1
DDBJ      :             conserved protein
Swiss-Prot:YBJQ_SALTY   RecName: Full=UPF0145 protein ybjQ;

Homologs  Archaea  13/68 : Bacteria  245/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.230.5
:107 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->107 1y2iA PDBj 3e-50 92.3 %
:RPS:SCOP  1->104 1vr4A1  d.230.5.1 * 2e-32 56.9 %
:HMM:SCOP  1->109 1y2iA_ d.230.5.1 * 3.1e-38 49.5 %
:RPS:PFM   4->104 PF01906 * DUF74 1e-26 64.0 %
:HMM:PFM   1->105 PF01906 * DUF74 5e-44 50.0 104/105  
:BLT:SWISS 1->107 YBJQ_SALTY 9e-57 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66655.1 GT:GENE ACF66655.1 GT:PRODUCT conserved protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1009920..1010243 GB:FROM 1009920 GB:TO 1010243 GB:DIRECTION + GB:PRODUCT conserved protein GB:NOTE identified by match to protein family HMM PF01906 GB:PROTEIN_ID ACF66655.1 GB:DB_XREF GI:194406436 LENGTH 107 SQ:AASEQ MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFQELGEQAKALGADAVVGIDIDYETVGKDGSMLMVSVSGTAVKTRR GT:EXON 1|1-107:0| SW:ID YBJQ_SALTY SW:DE RecName: Full=UPF0145 protein ybjQ; SW:GN Name=ybjQ; OrderedLocusNames=STM0930; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->107|YBJQ_SALTY|9e-57|100.0|107/107| BL:PDB:NREP 1 BL:PDB:REP 2->107|1y2iA|3e-50|92.3|104/106| RP:PFM:NREP 1 RP:PFM:REP 4->104|PF01906|1e-26|64.0|100/105|DUF74| HM:PFM:NREP 1 HM:PFM:REP 1->105|PF01906|5e-44|50.0|104/105|DUF74| RP:SCP:NREP 1 RP:SCP:REP 1->104|1vr4A1|2e-32|56.9|102/103|d.230.5.1| HM:SCP:REP 1->109|1y2iA_|3.1e-38|49.5|109/0|d.230.5.1|1/1|YbjQ-like| OP:NHOMO 296 OP:NHOMOORG 259 OP:PATTERN ----1-----------1------------11-121-1------1--1---1----1----1------- -----------11--------------------------------------------------------------111--11---1--1111-1-------------1-1-----------------------------------11--1---11------1-11-11111---------------2211--11122233221242333-211--423-111---11111111--------------------1-1-11--1--11----1----------------------------------------------------1----1111111111--111-1--11--1---1111112--1----1--1--1111---------------------------------------------------------1112-12111111-------------111------------------------------1--1--------------------------------------------1---------------------1-111---------------------1-----------------------1------------1-12-1--1-111------1-------------------------1111-111111111111-1111111111111111111---11---111111111121111211111111----------------1------1111--1--111-1-1-------1-1--111111------111--1111-----------------11111111111-----------------2------------------------------------------1--1-11111--- ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 107 STR:RPRED 100.0 SQ:SECSTR cEEccccccTTEEEEEEEEEEEEEEEEcHHHHHHHTTTccccccTTTcTHHHHHHHHHHHHHHHHHHHHHHHTccEEEEEEEEEEEEcTTccEEEEEEEEEEEEEEE PSIPRED cEEEcccccccEEEEEEEEEEEEEEEEEEcHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEHHHccccccEEEEEEEEEEEEEEc //