[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66663.1
DDBJ      :             protein YbgL
Swiss-Prot:YBGL_SALHS   RecName: Full=UPF0271 protein ybgL;

Homologs  Archaea  7/68 : Bacteria  405/915 : Eukaryota  31/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:244 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->221 1xw8A PDBj 9e-86 82.2 %
:RPS:PDB   1->220 2dfaA PDBj 3e-17 47.7 %
:RPS:SCOP  1->221 1v6tA  c.6.2.5 * 3e-33 44.0 %
:HMM:SCOP  1->245 1xw8A_ c.6.2.5 * 3.4e-89 51.4 %
:RPS:PFM   3->220 PF03746 * LamB_YcsF 2e-71 61.0 %
:HMM:PFM   2->237 PF03746 * LamB_YcsF 5.4e-100 53.4 236/242  
:BLT:SWISS 1->244 YBGL_SALHS e-128 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66663.1 GT:GENE ACF66663.1 GT:PRODUCT protein YbgL GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 828800..829534 GB:FROM 828800 GB:TO 829534 GB:DIRECTION + GB:PRODUCT protein YbgL GB:NOTE identified by match to protein family HMM PF03746 GB:PROTEIN_ID ACF66663.1 GB:DB_XREF GI:194406444 LENGTH 244 SQ:AASEQ MNIDLNADLGEGCASDSELLTLVSSANIACGFHAGDAQTMLTCVREALKNGVAIGAHPSFPDRDNLGRTAMVLPPETVYAQTLYQIGALGAIVQAQGGVMRHVKPHGMLYNQAAKDPRLAQAIAKAVHDYDPSLILVGLAGSELIRAGERHRLVTRQEVFADRGYQADGSLVPRTQPGALIHDEEQALAQTLDMVQAGRVKSVTGVWTTVTAQTVCIHGDGEYALAFARRLRAAFNARNIHVIA GT:EXON 1|1-244:0| SW:ID YBGL_SALHS SW:DE RecName: Full=UPF0271 protein ybgL; SW:GN Name=ybgL; OrderedLocusNames=SeHA_C0837; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->244|YBGL_SALHS|e-128|100.0|244/244| SEG 224->239|alafarrlraafnarn| BL:PDB:NREP 1 BL:PDB:REP 3->221|1xw8A|9e-86|82.2|202/224| RP:PDB:NREP 1 RP:PDB:REP 1->220|2dfaA|3e-17|47.7|220/247| RP:PFM:NREP 1 RP:PFM:REP 3->220|PF03746|2e-71|61.0|218/241|LamB_YcsF| HM:PFM:NREP 1 HM:PFM:REP 2->237|PF03746|5.4e-100|53.4|236/242|LamB_YcsF| RP:SCP:NREP 1 RP:SCP:REP 1->221|1v6tA|3e-33|44.0|216/249|c.6.2.5| HM:SCP:REP 1->245|1xw8A_|3.4e-89|51.4|245/0|c.6.2.5|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 528 OP:NHOMOORG 443 OP:PATTERN ------------------------------------------------------1111111------- --1-11-11111-1111----11112-----111111243111-1111-11-332111--11111111111--------11----------------------11-------------------------------111-----11-------------------------------------11111---1-111111111111111111111111111111--------2111111111111111111111-------1-------------1-------------------------------------------------1--1-----------111---------1--1-----1--11-111-11-------------1121211111111------------11211312----4223112321--1111-112111112111111111-111-1-1-----------------------------1-----221-11113212222222112222112211111--112--1--2--222--11---1---11111----1---1-1-----------------------1--1-----11111------------1------111111-111-----------1----12-------------1133-111111111111-1111111111111111111111211111111111111111111111111111-111111111111---1---------1--11-------1111-11-11111111-11-33331214222221332111-111-1-11111111111111-----------------------------------------------------------------------1- ---------------1-111111111111--------------111---1-111------------------2----------------112-----11-1---------------------------------------------------------1----1-------------------------1--------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 221 STR:RPRED 90.6 SQ:SECSTR cEEEEEEEEccccTTHHHHTTTccEEEEEcccccccHHHHHHHHHHHHHTTcEEEEEcccccTTTTTcccccccHHHHHHHHHHHHHHHHHHHHHTTcccccccccHHHHHHHHHcHHHHHHHHHHHHHHcTTccEEEcTTcHHHHHHHHTTccEEEEEcTTccccTTcccccTTcTTcccccHHHHHHHHHHHHHTcEEEcTTccEEEccccEEEEcccc####################### PSIPRED cEEEccccHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHccHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEccEEEEEEEEEEEEEcccHHHHHHHHHHHHHHHHcccEEEc //