[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66664.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:YBAB_SHISS   RecName: Full=UPF0133 protein ybaB;

Homologs  Archaea  0/68 : Bacteria  294/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.222.1
:109 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->104 1pugA PDBj 4e-30 100.0 %
:RPS:SCOP  40->98 1j8bA  d.222.1.1 * 5e-26 66.1 %
:HMM:SCOP  11->104 1pugA_ d.222.1.1 * 3e-36 59.6 %
:RPS:PFM   32->99 PF02575 * DUF149 6e-08 47.1 %
:HMM:PFM   11->102 PF02575 * DUF149 3.9e-40 60.9 92/93  
:BLT:SWISS 1->109 YBAB_SHISS 6e-37 100.0 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66664.1 GT:GENE ACF66664.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 590130..590459 GB:FROM 590130 GB:TO 590459 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF02575; match to protein family HMM TIGR00103 GB:PROTEIN_ID ACF66664.1 GB:DB_XREF GI:194406445 LENGTH 109 SQ:AASEQ MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF GT:EXON 1|1-109:0| SW:ID YBAB_SHISS SW:DE RecName: Full=UPF0133 protein ybaB; SW:GN Name=ybaB; OrderedLocusNames=SSON_0458; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->109|YBAB_SHISS|6e-37|100.0|109/109| COIL:NAA 35 COIL:NSEG 1 COIL:REGION 4->38| SEG 11->30|mkqaqqmqekmqkmqeeiaq| SEG 61->72|lleddkemledl| BL:PDB:NREP 1 BL:PDB:REP 31->104|1pugA|4e-30|100.0|74/94| RP:PFM:NREP 1 RP:PFM:REP 32->99|PF02575|6e-08|47.1|68/93|DUF149| HM:PFM:NREP 1 HM:PFM:REP 11->102|PF02575|3.9e-40|60.9|92/93|DUF149| RP:SCP:NREP 1 RP:SCP:REP 40->98|1j8bA|5e-26|66.1|59/92|d.222.1.1| HM:SCP:REP 11->104|1pugA_|3e-36|59.6|94/94|d.222.1.1|1/1|YbaB-like| OP:NHOMO 296 OP:NHOMOORG 296 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-1-------------------------------11---11-----------1-1---1-11---111111111---1111------------1----1--1--------------111111111111111111111111111111-1-1111111-111111-111111-111--------111-1---------------------------------------------------------111111111111111111111111111111111-1111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111--11-----11111-111111111111111111111111-11-11111111-11111111111--------11111111111111111111111111111----------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 67.9 SQ:SECSTR ##############################cEEEEEEGGGTEEEEEETTccEEEEEEcTHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccc##### DISOP:02AL 1-13,84-99| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEcccEEEEEEEccccEEEEEEcHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //