[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66718.1
DDBJ      :             acetyltransferase, gnat family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  113/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:174 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->164 1gheA_ d.108.1.1 * 2e-11 21.7 %
:HMM:PFM   86->146 PF00583 * Acetyltransf_1 1.1e-07 22.0 59/83  
:BLT:SWISS 14->164 Y4AS_RHISN 5e-07 29.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66718.1 GT:GENE ACF66718.1 GT:PRODUCT acetyltransferase, gnat family GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 3022137..3022661 GB:FROM 3022137 GB:TO 3022661 GB:DIRECTION + GB:PRODUCT acetyltransferase, gnat family GB:NOTE identified by match to protein family HMM PF00583 GB:PROTEIN_ID ACF66718.1 GB:DB_XREF GI:194406499 LENGTH 174 SQ:AASEQ MFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHALQNHEKGTTKTYVALDNSDITRIHGFYSVSPASLIYAQVPGAISKGLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLLSFKTLYAALSASGRL GT:EXON 1|1-174:0| BL:SWS:NREP 1 BL:SWS:REP 14->164|Y4AS_RHISN|5e-07|29.3|150/100| SEG 101->114|qgqglgaqlllsag| HM:PFM:NREP 1 HM:PFM:REP 86->146|PF00583|1.1e-07|22.0|59/83|Acetyltransf_1| HM:SCP:REP 1->164|1gheA_|2e-11|21.7|143/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 165 OP:NHOMOORG 114 OP:PATTERN -------------------------------------------------------------------- --2--------------11-11----11111--------------1---------------------------------------------------------------------------------1211--2-1--------------1------------11-1-----------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1-1-12--2----------1---------1------------3-2-1---------------------1--------------------------------------------1-1-111--2-------1-------1---------1--1----------2----------------31---2----------1---------4------1-------------------------111--3---------1222------2------1------2--------11-1--22-----1--2----1-1--2--------232--44-1-221-3111222222-2221-------------------1-------1----1-1111--------111-----------1----------------------------1---11211---------------1-------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 173-175| PSIPRED cccHHHHHccccHHcccccccccHHHHHHHHHHHHHHHHccccEEEEEEEcccccEEEEEEEEcccHHHHHHcHHHHHHccccccccEEEEEHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccEEEEEEEEccHHHHHHHHHcccEEccccccEEEEEHHHHHHHHHHHccc //