[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66723.1
DDBJ      :             secretion chaparone
Swiss-Prot:SICP_SALTY   RecName: Full=Chaperone protein sicP;

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.198.1
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->130 1jyoA PDBj 5e-72 99.2 %
:RPS:SCOP  1->130 1jyoA  d.198.1.1 * 4e-20 99.2 %
:HMM:SCOP  1->130 1jyoA_ d.198.1.1 * 8.3e-29 28.5 %
:HMM:PFM   5->120 PF05932 * CesT 2.5e-13 24.1 116/122  
:BLT:SWISS 15->130 SICP_SALTY 2e-63 99.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66723.1 GT:GENE ACF66723.1 GT:PRODUCT secretion chaparone GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2998203..2998595) GB:FROM 2998203 GB:TO 2998595 GB:DIRECTION - GB:PRODUCT secretion chaparone GB:NOTE identified by match to protein family HMM PF05932 GB:PROTEIN_ID ACF66723.1 GB:DB_XREF GI:194406504 LENGTH 130 SQ:AASEQ MQAHQDIIANIGEKLGLPLTFDDNNQCLLLLDSDIFTSIEAKDDIWLLNGMIIPLSPVCGDSIWRQIMVINGELAANNEGTLAYIDAAETLLLIHAITDLTNTYHIISQLESFVNQQEALKNILQEYAKV GT:EXON 1|1-130:0| SW:ID SICP_SALTY SW:DE RecName: Full=Chaperone protein sicP; SW:GN Name=sicP; OrderedLocusNames=STM2878; SW:KW 3D-structure; Chaperone; Complete proteome; Cytoplasm; Virulence. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 15->130|SICP_SALTY|2e-63|99.1|116/116| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0009405|"GO:pathogenesis"|Virulence| BL:PDB:NREP 1 BL:PDB:REP 1->130|1jyoA|5e-72|99.2|130/130| HM:PFM:NREP 1 HM:PFM:REP 5->120|PF05932|2.5e-13|24.1|116/122|CesT| RP:SCP:NREP 1 RP:SCP:REP 1->130|1jyoA|4e-20|99.2|130/130|d.198.1.1| HM:SCP:REP 1->130|1jyoA_|8.3e-29|28.5|130/0|d.198.1.1|1/1|Type III secretory system chaperone| OP:NHOMO 23 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----1111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 130 STR:RPRED 100.0 SQ:SECSTR cHHHHHHHHHHHHHHTccccccTTcEEEEEETTTEEEEEEEETTEEEEEEEEEEccTTccHHHHHHHHHHHHHHHHTTccEEEEEGGGTEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHGGGccc DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHccccEEEccccEEEEEEEcccEEEEcccccEEEEEccEEccccccHHHHHHHHHHHcccccccccccEEEEccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcc //