[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66731.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  123/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.100.2
:72 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->67 2khrA PDBj 2e-12 42.2 %
:RPS:SCOP  12->70 2pstX1  d.100.2.1 * 6e-10 23.7 %
:RPS:PFM   4->53 PF03621 * MbtH 2e-09 46.0 %
:HMM:PFM   1->54 PF03621 * MbtH 5.8e-24 43.4 53/54  
:BLT:SWISS 1->72 YBDZ_ECOLI 9e-29 66.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66731.1 GT:GENE ACF66731.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 693677..693895 GB:FROM 693677 GB:TO 693895 GB:DIRECTION + GB:PRODUCT conserved domain protein GB:NOTE identified by match to protein family HMM PF03621 GB:PROTEIN_ID ACF66731.1 GB:DB_XREF GI:194406512 LENGTH 72 SQ:AASEQ MEFSNPFDNPQGQFYILQNAQRQFSLWPAACALPAGWDVVCEPQSQDACQQWLNTRWTTLNPAHYADKQEAK GT:EXON 1|1-72:0| BL:SWS:NREP 1 BL:SWS:REP 1->72|YBDZ_ECOLI|9e-29|66.7|72/72| BL:PDB:NREP 1 BL:PDB:REP 4->67|2khrA|2e-12|42.2|64/74| RP:PFM:NREP 1 RP:PFM:REP 4->53|PF03621|2e-09|46.0|50/53|MbtH| HM:PFM:NREP 1 HM:PFM:REP 1->54|PF03621|5.8e-24|43.4|53/54|MbtH| RP:SCP:NREP 1 RP:SCP:REP 12->70|2pstX1|6e-10|23.7|59/61|d.100.2.1| OP:NHOMO 140 OP:NHOMOORG 123 OP:PATTERN -------------------------------------------------------------------- ----1------1-132111-11--3211111111112111-211---------11-----11--2231241--------------------------------------------------------------------------------------------------------------------------1111111111111111--11-1111----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------1111-1-1-11111-11-1121111111111111111111-----11111111111111111111--11-----------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 64 STR:RPRED 88.9 SQ:SECSTR ###ccccccccccEEEEEETTcccEEEETTccccccEEEEEccccHHHHHHHHHHHHHccccccccc##### DISOP:02AL 1-2,66-73| PSIPRED cccccccccccccEEEEEEcccEEEccccccccccccEEccccccHHHHHHHHHHHcccccHHHHHHHHHcc //