[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66736.1
DDBJ      :             secreted effector protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:138 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->70 PF09621 * LcrR 2e-13 50.0 %
:HMM:PFM   3->58 PF09621 * LcrR 5.3e-09 25.0 56/139  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66736.1 GT:GENE ACF66736.1 GT:PRODUCT secreted effector protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1492572..1492988 GB:FROM 1492572 GB:TO 1492988 GB:DIRECTION + GB:PRODUCT secreted effector protein GB:PROTEIN_ID ACF66736.1 GB:DB_XREF GI:194406517 LENGTH 138 SQ:AASEQ MVQEIEQWLRRHQVFTEPAYLGETAILLGQQFILSPYLVIYRIEAKEMIICEFRRLTPGQPRPQQLFHLLGLLRGIFVHHPQLTCLKMLIITDVLDEKKAMLRRKLLRILTVMGATFTQLDGDNWTVLSAEHLIQRRF GT:EXON 1|1-138:0| RP:PFM:NREP 1 RP:PFM:REP 5->70|PF09621|2e-13|50.0|66/126|LcrR| HM:PFM:NREP 1 HM:PFM:REP 3->58|PF09621|5.3e-09|25.0|56/139|LcrR| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111--------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,138-139| PSIPRED cHHHHHHHHHHccccccHHHHcccEEEEEEEEEEcccEEEEEEccccEEEEEEEEccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccEEEEEEccHHHHHcc //