[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66779.1
DDBJ      :             inner membrane protein YedI
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  258/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:303 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   21->292 PF05661 * DUF808 1e-76 65.9 %
:HMM:PFM   1->292 PF05661 * DUF808 9e-138 64.7 292/295  
:BLT:SWISS 21->303 YEDI_ECOLI e-118 76.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66779.1 GT:GENE ACF66779.1 GT:PRODUCT inner membrane protein YedI GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2119502..2120413) GB:FROM 2119502 GB:TO 2120413 GB:DIRECTION - GB:PRODUCT inner membrane protein YedI GB:NOTE identified by match to protein family HMM PF05661 GB:PROTEIN_ID ACF66779.1 GB:DB_XREF GI:194406560 LENGTH 303 SQ:AASEQ MAGSSLLTLLDDIATLLDDISVMGKLAAKKTAGVLGDDLSLNAQQVTGVRANRELPVVWSVAKGSLINKVILVPLALLISAFIPWAITPLLMLGGAFLCFEGVEKVLHTFEARKHKEDPAERQKRLEALAAQDPLAFEKDKVKGAVRTDFILSAEIVAITLGIVAQAPLLNQVLVLAGIALVVTIGVYGLVGIIVKLDDMGYWLAEKRSVLAQGVGKGLLIIAPWLMKALSIVGTLAMFLVGGGIVVHGIAPLHHAIEHFAQQQGAFMAHTIPAGLNLVLGFIIGAIVVALVKGVAKIRGVSH GT:EXON 1|1-303:0| BL:SWS:NREP 1 BL:SWS:REP 21->303|YEDI_ECOLI|e-118|76.3|283/305| TM:NTM 6 TM:REGION 3->25| TM:REGION 73->95| TM:REGION 150->172| TM:REGION 177->199| TM:REGION 225->247| TM:REGION 267->289| SEG 6->20|lltllddiatllddi| RP:PFM:NREP 1 RP:PFM:REP 21->292|PF05661|1e-76|65.9|267/288|DUF808| HM:PFM:NREP 1 HM:PFM:REP 1->292|PF05661|9e-138|64.7|292/295|DUF808| OP:NHOMO 262 OP:NHOMOORG 259 OP:PATTERN -------------------------------------------------------------------- -----1111111-1---11-11--111111111111-1-1----1-111---11111-----1------------------------------------1-1-111-1---------------------------------------------------------------------------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1111------------------11111111111-11111111--------11-111-------1111111111--------------1--------------------------------111------------------------------1---------111111-11---11-11--1111111---111----------------------------11--1-------------------2------11-1111-11-1111111111111111111-------------11--1111111111111-1111111111111-11--1111-----1111111111--1-1-11111111-----------------------1111-1-11111111---------11111-11211-11111112111111111---------1111-1111111-111111111111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,112-130,208-213,303-304| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccccccccccccccccccccEEHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //