[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66793.1
DDBJ      :             transcriptional regulator SlyA
Swiss-Prot:SLYA_SALTI   RecName: Full=Transcriptional regulator slyA;

Homologs  Archaea  2/68 : Bacteria  255/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->142 3deuA PDBj 1e-54 82.6 %
:RPS:PDB   3->142 3deuB PDBj 7e-23 83.8 %
:RPS:SCOP  7->136 2fbiA1  a.4.5.28 * 1e-18 24.0 %
:HMM:SCOP  1->138 1jgsA_ a.4.5.28 * 6.7e-32 36.8 %
:RPS:PFM   50->81 PF05732 * RepL 1e-04 40.6 %
:HMM:PFM   31->89 PF01047 * MarR 7.9e-21 41.4 58/59  
:BLT:SWISS 3->146 SLYA_SALTI 1e-78 99.3 %
:PROS 64->98|PS01117|HTH_MARR_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66793.1 GT:GENE ACF66793.1 GT:PRODUCT transcriptional regulator SlyA GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1567000..1567440 GB:FROM 1567000 GB:TO 1567440 GB:DIRECTION + GB:PRODUCT transcriptional regulator SlyA GB:NOTE identified by match to protein family HMM PF01047 GB:PROTEIN_ID ACF66793.1 GB:DB_XREF GI:194406574 LENGTH 146 SQ:AASEQ MKLESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLVAKLEHNIMELHSHD GT:EXON 1|1-146:0| SW:ID SLYA_SALTI SW:DE RecName: Full=Transcriptional regulator slyA; SW:GN Name=slyA; OrderedLocusNames=STY3045, t1312; SW:KW Activator; Complete proteome; DNA-binding; Repressor; Transcription;Transcription regulation; Virulence. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 3->146|SLYA_SALTI|1e-78|99.3|144/144| GO:SWS:NREP 4 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| GO:SWS GO:0009405|"GO:pathogenesis"|Virulence| PROS 64->98|PS01117|HTH_MARR_1|PDOC00861| BL:PDB:NREP 1 BL:PDB:REP 3->142|3deuA|1e-54|82.6|132/132| RP:PDB:NREP 1 RP:PDB:REP 3->142|3deuB|7e-23|83.8|130/130| RP:PFM:NREP 1 RP:PFM:REP 50->81|PF05732|1e-04|40.6|32/140|RepL| HM:PFM:NREP 1 HM:PFM:REP 31->89|PF01047|7.9e-21|41.4|58/59|MarR| GO:PFM:NREP 2 GO:PFM GO:0006260|"GO:DNA replication"|PF05732|IPR008813| GO:PFM GO:0006276|"GO:plasmid maintenance"|PF05732|IPR008813| RP:SCP:NREP 1 RP:SCP:REP 7->136|2fbiA1|1e-18|24.0|129/136|a.4.5.28| HM:SCP:REP 1->138|1jgsA_|6.7e-32|36.8|136/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 351 OP:NHOMOORG 259 OP:PATTERN ------1-------------------------------------1----------------------- ----1---------1------------------------1----------------------------------------1--------------------------------------------1----------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------1------------------111---------11------------------1--------212321-1-----33233333224--11--1111---311111-1111122----12-------22222222-22-1--2------------------------------1-1--222221111111----1112------212---1--------2221--2--11----1-----------------------1-112-111-11111---------------------------------1111-13--111-11111-1-222111--11-1-1----------23221221111111111-111111111111111111133311211111111111111111111111111111111111111-1111--1-111111--21--------------------------2-11113222132321333--------------------1---1111111111--------11----------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 97.9 SQ:SECSTR HHccccHHHHHHHHHHHHHHHHHHHTGGGTccHHHHHHHHHHHTccccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEcccEEcTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTccHHHHHHHHHHHHHHHHHHHHcH### DISOP:02AL 138-139,141-147| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccc //