[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66797.1
DDBJ      :             putative fimbrial subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  75/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.2.3
:186 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->156 2jtyA PDBj 1e-10 33.6 %
:RPS:PDB   40->185 3bfqG PDBj 1e-10 21.7 %
:RPS:SCOP  31->185 2j2zB1  b.2.3.2 * 2e-21 17.4 %
:HMM:SCOP  37->186 1pdkB_ b.2.3.2 * 8.5e-25 37.1 %
:RPS:PFM   30->185 PF00419 * Fimbrial 4e-08 33.6 %
:HMM:PFM   29->185 PF00419 * Fimbrial 6.2e-29 33.6 146/153  
:BLT:SWISS 16->185 FMA_SERMA 1e-21 38.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66797.1 GT:GENE ACF66797.1 GT:PRODUCT putative fimbrial subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 238397..238957 GB:FROM 238397 GB:TO 238957 GB:DIRECTION + GB:PRODUCT putative fimbrial subunit GB:NOTE identified by match to protein family HMM PF00419 GB:PROTEIN_ID ACF66797.1 GB:DB_XREF GI:194406578 LENGTH 186 SQ:AASEQ MNTAVKAAVAAALVMGVSSFANAAGSNTGTVTFTGTIEDSPCSIVVGDEHQTVNLGHIGTGSLMGGKESSKVDFHIGLENCAFTTEKEASTVFSAIGNESSANPGSVALMRIGGGEMAGSSIVIGNHLGSAIKLGDAYSENLTMNGSVAAAKQTLNFKAWVKGDSAATTIDTGEFSSTVNFTISYL GT:EXON 1|1-186:0| BL:SWS:NREP 1 BL:SWS:REP 16->185|FMA_SERMA|1e-21|38.4|159/174| SEG 4->14|avkaavaaalv| BL:PDB:NREP 1 BL:PDB:REP 27->156|2jtyA|1e-10|33.6|119/184| RP:PDB:NREP 1 RP:PDB:REP 40->185|3bfqG|1e-10|21.7|129/132| RP:PFM:NREP 1 RP:PFM:REP 30->185|PF00419|4e-08|33.6|149/152|Fimbrial| HM:PFM:NREP 1 HM:PFM:REP 29->185|PF00419|6.2e-29|33.6|146/153|Fimbrial| RP:SCP:NREP 1 RP:SCP:REP 31->185|2j2zB1|2e-21|17.4|144/150|b.2.3.2| HM:SCP:REP 37->186|1pdkB_|8.5e-25|37.1|140/0|b.2.3.2|1/1|Bacterial adhesins| OP:NHOMO 153 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------------------1----132444234412-4122222211443112112111111363-323-33323-2-2331-22221--111121111222------------------------1---------------------------1---------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 85.5 SQ:SECSTR ##########################ccccccccccccccccEEccccHEcccccccccTGGGccTcccccEEEEEEEEcccTTccEEEEEEEETEccccTTccEEcccccccTccccccEEEEEETTcccccTTcEEEEEccTTTTcETccEEEEEEEEEEcccccccccccccccccEEEEEE# DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEccccEEcccccEEEEEcccccHHHHccccEEEEEEEEEEEEEcccccccEEEEEEEEcccccccccccEEEEccccccccEEEEEEEcccccEEEEccccccEEEcccccccccEEEEEEEEEEEEccccccccEEEEEEEEEEEEEc //