[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66816.1
DDBJ      :             putative cytoplasmic protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:53 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->45 PF03262 * Corona_6B_7B 0.00091 29.0 31/209  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66816.1 GT:GENE ACF66816.1 GT:PRODUCT putative cytoplasmic protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2129327..2129488) GB:FROM 2129327 GB:TO 2129488 GB:DIRECTION - GB:PRODUCT putative cytoplasmic protein GB:PROTEIN_ID ACF66816.1 GB:DB_XREF GI:194406597 LENGTH 53 SQ:AASEQ MGAGQKINCCEGNALARGDNLRCGTVDAVQKIWPPGWLKYAHMTIQPENLQNP GT:EXON 1|1-53:0| HM:PFM:NREP 1 HM:PFM:REP 14->45|PF03262|0.00091|29.0|31/209|Corona_6B_7B| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-1-11-111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,48-54| PSIPRED cccccEEccccccccccccccccccHHHHHHHcccccEEEEEEEEcccccccc //