[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66825.1
DDBJ      :             protein RfbU
Swiss-Prot:RFBU_SALTY   RecName: Full=Protein rfbU;         EC=2.4.-.-;

Homologs  Archaea  42/68 : Bacteria  311/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
c.87.1d.157.1
:353 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   216->290 3c4qA PDBj 2e-07 35.2 %
:BLT:PDB   269->338 2gejA PDBj 2e-05 40.0 %
:RPS:PDB   14->341 3c48A PDBj 4e-34 16.5 %
:RPS:SCOP  21->124 2dkfA1  d.157.1.10 * 3e-05 16.8 %
:RPS:SCOP  181->328 2f9fA1  c.87.1.8 * 9e-26 29.9 %
:HMM:SCOP  12->351 2bisA1 c.87.1.8 * 1.3e-47 25.7 %
:RPS:PFM   188->328 PF00534 * Glycos_transf_1 1e-13 36.4 %
:HMM:PFM   178->330 PF00534 * Glycos_transf_1 7.6e-30 31.4 153/172  
:BLT:SWISS 1->353 RFBU_SALTY 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66825.1 GT:GENE ACF66825.1 GT:PRODUCT protein RfbU GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2213857..2214918) GB:FROM 2213857 GB:TO 2214918 GB:DIRECTION - GB:PRODUCT protein RfbU GB:NOTE identified by match to protein family HMM PF00534 GB:PROTEIN_ID ACF66825.1 GB:DB_XREF GI:194406606 LENGTH 353 SQ:AASEQ MIVNLSRLGKSGTGMWQYSIKFLTALREIADVDAIICSKVHADYFEKLGYAVVTVPNIVSNTSKTSRLRPLVWYVYSYWLALRVLIKFGNKKLVCTTHHTIPLLRNQTITVHDIRPFYYPDSFIQKVYFRFLLKMSVKRCKHVLTVSYTVKDSIAKTYNVDSEKISVIYNSVNKSDFIQKKEKENYFLAVGASWPHKNIHSFIKNKKVWSDSYNLIIVCGRTDYAMSLQQMVVDLELKDKVTFLHEVSFNELKILYSKAYALVYPSIDEGFGIPPIEAMASNTPVIVSDIPVFHEVLTNGALYVNPDDEKSWQSAIKNIEQLPDAISRFNNYVARYDFDNMKQMVGNWLAESK GT:EXON 1|1-353:0| SW:ID RFBU_SALTY SW:DE RecName: Full=Protein rfbU; EC=2.4.-.-; SW:GN Name=rfbU; OrderedLocusNames=STM2086; SW:KW Complete proteome; Glycosyltransferase;Lipopolysaccharide biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->353|RFBU_SALTY|0.0|100.0|353/353| GO:SWS:NREP 3 GO:SWS GO:0016757|"GO:transferase activity, transferring glycosyl groups"|Glycosyltransferase| GO:SWS GO:0009103|"GO:lipopolysaccharide biosynthetic process"|Lipopolysaccharide biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 2 BL:PDB:REP 216->290|3c4qA|2e-07|35.2|71/393| BL:PDB:REP 269->338|2gejA|2e-05|40.0|70/361| RP:PDB:NREP 1 RP:PDB:REP 14->341|3c48A|4e-34|16.5|328/399| RP:PFM:NREP 1 RP:PFM:REP 188->328|PF00534|1e-13|36.4|140/165|Glycos_transf_1| HM:PFM:NREP 1 HM:PFM:REP 178->330|PF00534|7.6e-30|31.4|153/172|Glycos_transf_1| GO:PFM:NREP 1 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00534|IPR001296| RP:SCP:NREP 2 RP:SCP:REP 21->124|2dkfA1|3e-05|16.8|101/431|d.157.1.10| RP:SCP:REP 181->328|2f9fA1|9e-26|29.9|147/166|c.87.1.8| HM:SCP:REP 12->351|2bisA1|1.3e-47|25.7|339/0|c.87.1.8|1/1|UDP-Glycosyltransferase/glycogen phosphorylase| OP:NHOMO 651 OP:NHOMOORG 361 OP:PATTERN --1-----332212-111---113----11--1-222321111-21232-422-11-112-221-1-- -15---1--------------1--1--------111---11-13-----331111--111111-211----------------3-1-11--2-311---225211432-2---------------2--22--1-3-67798---621252764--33-----114-322331-12-1---2-1-11--11-2-----------1---11-1-----1--1-----------1-------------------------------------------1-----------------------------------------------1--423333333232--334222-21---122---212-1--12223----112---1--1-1-2-32--1---11111111111-------122----211---2-11-2321--11-----------------331-21--------------------------------21-1-----2112321222211142222222211-2----2-----1--3-----1-1------------11----213-211-3----21-22--4----1-2-1----1--1-------------3--22331--1-11------1-------------------1-----------22-1----------2--1-----11----11-11--2-2----1-11111111-1113-1-------2--111111111-1----------2----1-----------------------1----12222-13112--11122111111111-1----------111---111-----------1662233------------------------------------------1------ -------------------------------------------------------------------------1------111------------------------1-------------------------------------------------------1---------------C----------1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 353 STR:RPRED 100.0 SQ:SECSTR TTHHHTTccTTcccHHHHHHHHHHHHHHTTEEEEEEEcccGGGccEEEEETTEEEEEEcccccccccGGGGGGGHHHHHHHHHHHHHHHTccccEEEEEHHHHHccEEEEccccHHHHcccccHHHHHHHHHHHHHHHHccEEEEccHHHHHHHHHHHcccGGGEEEccccccTTTcccccHHHHEEEEEccccGGGcHHHHHHHHHHHHHcTTccEEEEEcccccHHHHHHHHTTcTTTEEEEccccHHHHHHHHHHccEEEEccccccccHHHHHHHHTTccEEEEccTTHHHHcccTEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 353-354| PSIPRED cEEccccccccccHHHHHHHHHHHHHHHHccEEEEEcccccccccHHcccccEEcccEEEcccHHHHccHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccEEEEEcccHHHHccHHHHHHHHHHHHHHHHHHHccEEEEccHHHHHHHHHHccccHHHEEEEcccccHHHcccccccccEEEEEEEccccccHHHHHHHHHHccHHccEEEEEcccHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHccEEEEccccccccHHHHHHHHccccEEEEccccHHHEEcccEEEEccccHHHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHcc //