[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66834.1
DDBJ      :             glutaredoxin
Swiss-Prot:NRDH_SALTY   RecName: Full=Glutaredoxin-like protein nrdH;

Homologs  Archaea  0/68 : Bacteria  214/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
c.47.1
:81 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->76 1h75A PDBj 2e-37 85.5 %
:RPS:PDB   1->73 2ct6A PDBj 1e-09 18.3 %
:RPS:SCOP  1->76 1h75A  c.47.1.1 * 2e-32 85.5 %
:HMM:SCOP  1->76 1h75A_ c.47.1.1 * 1.5e-20 30.3 %
:RPS:PFM   3->54 PF00462 * Glutaredoxin 7e-04 32.7 %
:HMM:PFM   3->58 PF00462 * Glutaredoxin 2.1e-15 26.8 56/60  
:BLT:SWISS 1->81 NRDH_SALTY 3e-45 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66834.1 GT:GENE ACF66834.1 GT:PRODUCT glutaredoxin GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2926368..2926613 GB:FROM 2926368 GB:TO 2926613 GB:DIRECTION + GB:PRODUCT glutaredoxin GB:NOTE identified by match to protein family HMM PF00462; match to protein family HMM TIGR02194 GB:PROTEIN_ID ACF66834.1 GB:DB_XREF GI:194406615 LENGTH 81 SQ:AASEQ MSITIYTRNNCVQCHATKRAMESRGFEFEMVNVDLVPDAADTLRAQGFRQLPVVMAGDLSWSGFRPDMINRLHPTPHAANA GT:EXON 1|1-81:0| SW:ID NRDH_SALTY SW:DE RecName: Full=Glutaredoxin-like protein nrdH; SW:GN Name=nrdH; OrderedLocusNames=STM2805; SW:KW Complete proteome; Disulfide bond; Electron transport;Redox-active center; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->81|NRDH_SALTY|3e-45|100.0|81/81| GO:SWS:NREP 2 GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0006810|"GO:transport"|Transport| BL:PDB:NREP 1 BL:PDB:REP 1->76|1h75A|2e-37|85.5|76/76| RP:PDB:NREP 1 RP:PDB:REP 1->73|2ct6A|1e-09|18.3|71/111| RP:PFM:NREP 1 RP:PFM:REP 3->54|PF00462|7e-04|32.7|52/60|Glutaredoxin| HM:PFM:NREP 1 HM:PFM:REP 3->58|PF00462|2.1e-15|26.8|56/60|Glutaredoxin| GO:PFM:NREP 3 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00462|IPR002109| GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF00462|IPR002109| GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF00462|IPR002109| RP:SCP:NREP 1 RP:SCP:REP 1->76|1h75A|2e-32|85.5|76/76|c.47.1.1| HM:SCP:REP 1->76|1h75A_|1.5e-20|30.3|76/76|c.47.1.1|1/1|Thioredoxin-like| OP:NHOMO 224 OP:NHOMOORG 215 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-11111211111111123232----111-1---111111--------------111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11-1---111111111112-111111-111111111111111111111111-111111-1111111---------------------------------------------------------11111-------------11111111111-------------111111-111---------1-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-111111111--1-1111111111111111111111111111111111111111111111111111-11111111-111----------------1------------------------------------------------------------------1--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 95.1 SQ:SECSTR ccEEEEEccccccHHHHHHHHHHTTccEEEEETTTcHHHHHHHHHcccccccEEEETTEEEEEHHHHHHHHHHcccc#### DISOP:02AL 75-82| PSIPRED cEEEEEEccccHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHcccccccEEEEccEEEEcccHHHHHHHHHHHccccc //