[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66842.1
DDBJ      :             protein PrgJ
Swiss-Prot:PRGJ_SALTY   RecName: Full=Protein prgJ;

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:80 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   20->79 PF09392 * MxiH 1.3e-07 21.7 60/90  
:BLT:SWISS 1->80 PRGJ_SALTY 6e-40 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66842.1 GT:GENE ACF66842.1 GT:PRODUCT protein PrgJ GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2990265..2990507) GB:FROM 2990265 GB:TO 2990507 GB:DIRECTION - GB:PRODUCT protein PrgJ GB:PROTEIN_ID ACF66842.1 GB:DB_XREF GI:194406623 LENGTH 80 SQ:AASEQ METDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS GT:EXON 1|1-80:0| SW:ID PRGJ_SALTY SW:DE RecName: Full=Protein prgJ; SW:GN Name=prgJ; OrderedLocusNames=STM2872; SW:KW Complete proteome; Protein transport; Transport; Virulence. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->80|PRGJ_SALTY|6e-40|100.0|80/101| GO:SWS:NREP 3 GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0006810|"GO:transport"|Transport| GO:SWS GO:0009405|"GO:pathogenesis"|Virulence| HM:PFM:NREP 1 HM:PFM:REP 20->79|PF09392|1.3e-07|21.7|60/90|MxiH| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //