[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66869.1
DDBJ      :             competence/damage-inducible protein CinA domain protein
Swiss-Prot:YGAD_ECOLI   RecName: Full=Protein ygaD;

Homologs  Archaea  8/68 : Bacteria  728/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
c.51.5
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->157 2a9sB PDBj 9e-32 52.9 %
:RPS:PDB   1->159 2a9sA PDBj 9e-52 44.0 %
:RPS:SCOP  1->157 2a9sA1  c.51.5.1 * 3e-53 44.6 %
:HMM:SCOP  1->164 2a9sA1 c.51.5.1 * 1.9e-55 52.4 %
:RPS:PFM   9->157 PF02464 * CinA 6e-36 58.1 %
:HMM:PFM   8->159 PF02464 * CinA 1.1e-63 55.6 151/155  
:BLT:SWISS 1->165 YGAD_ECOLI 1e-85 92.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66869.1 GT:GENE ACF66869.1 GT:PRODUCT competence/damage-inducible protein CinA domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2950510..2951007) GB:FROM 2950510 GB:TO 2951007 GB:DIRECTION - GB:PRODUCT competence/damage-inducible protein CinA domain protein GB:NOTE identified by match to protein family HMM PF02464; match to protein family HMM TIGR00199 GB:PROTEIN_ID ACF66869.1 GB:DB_XREF GI:194406650 LENGTH 165 SQ:AASEQ MTDSELMRLSEQVGLALKARGATVTTAESCTGGWLAKAITDIAGSSAWFERSFVTYSNEAKAQMIGVREETLAQHGAVSEPVVVEMAIGALKAARADFAVAISGIAGPDGGSEEKPVGTVWFAFASVSGEGITRRECFSGDRESVRRQATTYALQTLWQQFLQNT GT:EXON 1|1-165:0| SW:ID YGAD_ECOLI SW:DE RecName: Full=Protein ygaD; SW:GN Name=ygaD; OrderedLocusNames=b2700, JW2670; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->165|YGAD_ECOLI|1e-85|92.1|165/165| BL:PDB:NREP 1 BL:PDB:REP 21->157|2a9sB|9e-32|52.9|136/165| RP:PDB:NREP 1 RP:PDB:REP 1->159|2a9sA|9e-52|44.0|159/167| RP:PFM:NREP 1 RP:PFM:REP 9->157|PF02464|6e-36|58.1|148/155|CinA| HM:PFM:NREP 1 HM:PFM:REP 8->159|PF02464|1.1e-63|55.6|151/155|CinA| RP:SCP:NREP 1 RP:SCP:REP 1->157|2a9sA1|3e-53|44.6|157/167|c.51.5.1| HM:SCP:REP 1->164|2a9sA1|1.9e-55|52.4|164/0|c.51.5.1|1/1|CinA-like| OP:NHOMO 835 OP:NHOMOORG 747 OP:PATTERN ------------------------11111111------------------------------------ 1111111111111111111-111111111111211112211111--11---11111-1--1111-111111-111---11111111111111-1111--1-211111111---------------11111111111-----111111111111111111111-11111111-11111111111---1111-111111111111111111111111111111111111111111--------------------1-1-11-1---111111--1-------1111111111111111111111111111111111--111---111111111111111111111111111-111-1111111111111111-1-11-3112-1111112111111111211111111111-11111111111-111111111111111111112122111111111111111111111111111--11-----------------1111111121211111121111111211111111222212111111111111111121111111111111111122111111111111111-11111111111-12111111111111111111111111111111111111111111111111111111111111---1111------12111212221211122-222211121221122222223211111222222222222222212222222--111111111111---111111111111111-------------------------2122221221222212111---------111111111111111111111111111111-11111111--------1-1----1--11---1----111--1111111111111111 -----------------------1-1----------2----------1-1-111-----------------------------------1-------------------------------------------------------------------------2------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 96.4 SQ:SECSTR cccHHHHHHHHHHHHHHHHHTccEEEEEcTTTTHHHHHHTTcTTGGGTEEEEEEcccHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHTccccEEEEEEEccccccccccccTTEEEEEEEETTccEEEEEEEccccHHHHHHHHHHHHHHHHHH###### DISOP:02AL 1-2,164-166| PSIPRED cccHHHHHHHHHHHHHHHHcccEEEEHHHHcHHHHHHHHHcccccHHHHcccEEEEcHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHccccEEEEEEEEEccccccccccccEEEEEEEEccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcc //