[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66905.1
DDBJ      :             tetratricopeptide repeat protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  354/915 : Eukaryota  184/199 : Viruses  1/175   --->[See Alignment]
a.118.18
:509 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   66->301 1ouvA PDBj 6e-18 28.4 %
:BLT:PDB   330->489 1ouvA PDBj 4e-13 27.5 %
:RPS:PDB   31->444 3e4bC PDBj 9e-44 19.9 %
:RPS:SCOP  64->212 1klxA  a.118.18.1 * 3e-11 24.2 %
:RPS:SCOP  325->451 1klxA  a.118.18.1 * 2e-13 25.0 %
:HMM:SCOP  37->155 1ouvA_ a.118.18.1 * 3.2e-25 35.3 %
:HMM:SCOP  170->321 1ouvA_ a.118.18.1 * 1.3e-25 29.6 %
:HMM:SCOP  326->467 1ouvA_ a.118.18.1 * 6.9e-34 39.1 %
:RPS:PFM   170->202 PF08238 * Sel1 9e-04 54.5 %
:RPS:PFM   318->347 PF08238 * Sel1 5e-05 56.7 %
:RPS:PFM   384->418 PF08238 * Sel1 1e-05 60.0 %
:HMM:PFM   52->86 PF08238 * Sel1 1.7e-11 42.9 35/39  
:HMM:PFM   90->122 PF08238 * Sel1 1.1e-08 51.5 33/39  
:HMM:PFM   129->155 PF08238 * Sel1 1.3e-08 51.9 27/39  
:HMM:PFM   171->203 PF08238 * Sel1 4.3e-10 45.5 33/39  
:HMM:PFM   207->234 PF08238 * Sel1 5.7e-09 42.9 28/39  
:HMM:PFM   279->310 PF08238 * Sel1 2.6e-09 56.2 32/39  
:HMM:PFM   312->346 PF08238 * Sel1 1.4e-11 54.3 35/39  
:HMM:PFM   348->382 PF08238 * Sel1 2.3e-10 42.9 35/39  
:HMM:PFM   384->418 PF08238 * Sel1 4.1e-13 60.0 35/39  
:HMM:PFM   421->452 PF08238 * Sel1 8.3e-09 46.9 32/39  
:BLT:SWISS 42->346 YBEQ_ECOLI 3e-32 37.6 %
:BLT:SWISS 318->432 YBET_ECOLI 1e-18 39.1 %
:REPEAT 10|37->72|73->108|109->144|145->191|192->227|262->297|298->333|334->369|370->405|406->442
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66905.1 GT:GENE ACF66905.1 GT:PRODUCT tetratricopeptide repeat protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1901530..1903059) GB:FROM 1901530 GB:TO 1903059 GB:DIRECTION - GB:PRODUCT tetratricopeptide repeat protein GB:NOTE identified by match to protein family HMM PF08238 GB:PROTEIN_ID ACF66905.1 GB:DB_XREF GI:194406686 LENGTH 509 SQ:AASEQ MRFSSIFKIIILNIFISKMAHAAVCEERYPADSEECQYVQELEQKAEQGDESAQFSLGSWYAEGRYVKPDYKLAIKWLEKAGKQGSDFSYFILGYHYNYGENFPLSRQKALEWYRKAAELGDSSTQEILGDAYMYGDGFPQNTQLALEWYRKAASPTNDAGVVRGQGSASSAQFKLGVMYAHGQGVPQDYQQTAILMRKAAENMYYPAQLYLGVAYFYGEGVPQDYRQAVYWLNEGIPGSYTPGHIPLNALYDKAHPADRVHSQTWYRKTAQRVMAKVQYNFGVWYYNGYHLLKDHNLALEWYRRAAAQGLAEAQDAIGVMFMQGEGVSQDYQQALAWYRKAARQGLPAAQTHLGIMSAFGRGVAQSDRQAIAWYRKAAKQDFAKAQYQLGVAYSTGRGVPENSRNALKWYLKAAEQGFTPAQSALGEIYAHGRQGVPKDNKQAYIWYYMASMYTEKSKDDCSALIAERNRLKGTLTPDQLSETYAAFNLIWRKIDQSKEAKKIARKKY GT:EXON 1|1-509:0| BL:SWS:NREP 2 BL:SWS:REP 42->346|YBEQ_ECOLI|3e-32|37.6|258/325| BL:SWS:REP 318->432|YBET_ECOLI|1e-18|39.1|115/184| NREPEAT 1 REPEAT 10|37->72|73->108|109->144|145->191|192->227|262->297|298->333|334->369|370->405|406->442| SEG 3->17|fssifkiiilnifis| SEG 306->317|aaaqglaeaqda| BL:PDB:NREP 2 BL:PDB:REP 66->301|1ouvA|6e-18|28.4|225/265| BL:PDB:REP 330->489|1ouvA|4e-13|27.5|155/265| RP:PDB:NREP 1 RP:PDB:REP 31->444|3e4bC|9e-44|19.9|361/405| RP:PFM:NREP 3 RP:PFM:REP 170->202|PF08238|9e-04|54.5|33/36|Sel1| RP:PFM:REP 318->347|PF08238|5e-05|56.7|30/36|Sel1| RP:PFM:REP 384->418|PF08238|1e-05|60.0|35/36|Sel1| HM:PFM:NREP 10 HM:PFM:REP 52->86|PF08238|1.7e-11|42.9|35/39|Sel1| HM:PFM:REP 90->122|PF08238|1.1e-08|51.5|33/39|Sel1| HM:PFM:REP 129->155|PF08238|1.3e-08|51.9|27/39|Sel1| HM:PFM:REP 171->203|PF08238|4.3e-10|45.5|33/39|Sel1| HM:PFM:REP 207->234|PF08238|5.7e-09|42.9|28/39|Sel1| HM:PFM:REP 279->310|PF08238|2.6e-09|56.2|32/39|Sel1| HM:PFM:REP 312->346|PF08238|1.4e-11|54.3|35/39|Sel1| HM:PFM:REP 348->382|PF08238|2.3e-10|42.9|35/39|Sel1| HM:PFM:REP 384->418|PF08238|4.1e-13|60.0|35/39|Sel1| HM:PFM:REP 421->452|PF08238|8.3e-09|46.9|32/39|Sel1| RP:SCP:NREP 2 RP:SCP:REP 64->212|1klxA|3e-11|24.2|132/133|a.118.18.1| RP:SCP:REP 325->451|1klxA|2e-13|25.0|120/133|a.118.18.1| HM:SCP:REP 37->155|1ouvA_|3.2e-25|35.3|119/0|a.118.18.1|1/3|HCP-like| HM:SCP:REP 170->321|1ouvA_|1.3e-25|29.6|152/0|a.118.18.1|2/3|HCP-like| HM:SCP:REP 326->467|1ouvA_|6.9e-34|39.1|138/0|a.118.18.1|3/3|HCP-like| OP:NHOMO 1428 OP:NHOMOORG 539 OP:PATTERN -------------------------------------------------------------------- -11------------------------------------------------------------------------------1--2---1111----Y---3----2------------------72121-1112--------------------------------------------------------1------------------------------2-----------------------------------------------------1-11-------------------------------------------------1111-111-1-111------------3-2-1-------------1--1112----1-233433332223222222222222-45533525235-52223323433225224---1-111--111111111121122---------------------------------1-B-----2443321222222112222224131111--2213----1--1----112-11-12211124131---3-12---332212-541--241----1-1-43411------142667657731--233321--12--13-112111-111-111--21---11-1------1--1-1-2223212-2--12422-12-21-3-22--4---12--142624-6455414124-1113342---11111111111----2212254552-3-1----11-4-2413123262313242--2222111-3121--------------1433------112221111111-------11D---------------1-------------------------------------224 1---132-1-1-54A22-22222333233233333233231333331233233333223333211-1111111121---112222111-13121211112212IHE286u41111122111242441213A2-323232232123131324213212232111311-11241138111mC1221141-6122117756w --------------------------------------------------------------------------------------------------------------------------------------------------------------------------3---- STR:NPRED 461 STR:RPRED 90.6 SQ:SECSTR ############################cTcccccHHHHHHHHHHTTTcHHHHHHHHHHHHHcTTccHHHHHHHHHHHHHHHHTTccccHHHHHHHHHcGGGcTccHHHHHHHHHHTTcTTHHHHHHHHHHHHHHHHTcGGGcHHHHHHHHHHHTTTcTccHHHHHHTTcTHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHTcTccccHHHHHHHHHHHTTTccccHHHHHHHHHHcccGGGHHHHHHHHHTHHHHHHHHHHHHcGHHHHHTcTGGccHHHHHHHHHHHHHTTcHHHHHHHHHHHHHcccccccHHHHHHHHHTTTTTccHHHHHHHHHHHHHTccccccHHHHHHHHHHHHHTTcTTTTHHHHHHHHTcTTccccHHHHHHHHHHHGGGccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHTHHTTcTccHHHHHHHHHHHHHHTTccHHHHHHHHHHHH#################### DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHcccc //