[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66927.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:41 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->38 PF10007 * DUF2250 0.00039 23.3 30/93  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66927.1 GT:GENE ACF66927.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 856596..856721 GB:FROM 856596 GB:TO 856721 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF66927.1 GB:DB_XREF GI:194406708 LENGTH 41 SQ:AASEQ MLVNSFAANTDAVLVKYLPTSLETDYALSAMKKTHCSITLC GT:EXON 1|1-41:0| HM:PFM:NREP 1 HM:PFM:REP 9->38|PF10007|0.00039|23.3|30/93|DUF2250| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11-1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,7-7| PSIPRED cccccccccccEEEEEEcccccccHHHHHHHHHccEEEEEc //