[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66937.1
DDBJ      :             alcohol dehydrogenase, propanol-preferring
Swiss-Prot:ADHP_ECOLI   RecName: Full=Alcohol dehydrogenase, propanol-preferring;         EC=1.1.1.1;

Homologs  Archaea  49/68 : Bacteria  734/915 : Eukaryota  191/199 : Viruses  1/175   --->[See Alignment]
b.35.1c.2.1c.30.1
:336 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->332 1rjwA PDBj 6e-82 49.8 %
:RPS:PDB   1->335 2cf5A PDBj 3e-48 23.5 %
:RPS:SCOP  1->182 1kolA1  b.35.1.2 * 2e-35 20.9 %
:RPS:SCOP  156->216 1a9xA3  c.30.1.1 * 7e-08 9.8 %
:HMM:SCOP  1->179 1jqbA1 b.35.1.2 * 7.1e-52 41.3 %
:HMM:SCOP  134->303 1d1tA2 c.2.1.1 * 1.2e-42 38.8 %
:RPS:PFM   25->126 PF08240 * ADH_N 5e-20 48.5 %
:RPS:PFM   172->224 PF00107 * ADH_zinc_N 1e-06 46.2 %
:HMM:PFM   25->131 PF08240 * ADH_N 2.2e-33 45.3 106/109  
:HMM:PFM   172->298 PF00107 * ADH_zinc_N 2.6e-31 40.5 126/130  
:BLT:SWISS 1->335 ADHP_ECOLI e-160 92.8 %
:PROS 57->71|PS00059|ADH_ZINC
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66937.1 GT:GENE ACF66937.1 GT:PRODUCT alcohol dehydrogenase, propanol-preferring GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1696644..1697654 GB:FROM 1696644 GB:TO 1697654 GB:DIRECTION + GB:PRODUCT alcohol dehydrogenase, propanol-preferring GB:NOTE identified by match to protein family HMM PF00107; match to protein family HMM PF08240 GB:PROTEIN_ID ACF66937.1 GB:DB_XREF GI:194406718 LENGTH 336 SQ:AASEQ MKAAVVTQDHQVDVTEKTLRPLRHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEGIGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNTGNETLCRNVKNAGYTVDGGMAEECIVVADYAVKVPEGLDSAAASSITCAGVTTYKAVKISHIKPGQWIAIYGLGGLGNLALQYAKNVFNAKVIAIDVNDGQLKLAEEMGADLTINSRTEDAAKIVQEKTGGAHAAVVTAVAKAAFNSAVDAVRAGGRVVAVGLPPEAMNLDIPRLVLDGIQVVGSLVGTRQDLTEAFQFAAEGKVVPKVALRPLEDINVIFKEMEQGQIRGRMVIDFRR GT:EXON 1|1-336:0| SW:ID ADHP_ECOLI SW:DE RecName: Full=Alcohol dehydrogenase, propanol-preferring; EC=1.1.1.1; SW:GN Name=adhP; Synonyms=yddN; OrderedLocusNames=b1478, JW1474; SW:KW Complete proteome; Direct protein sequencing; Metal-binding; NAD;Oxidoreductase; Zinc. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->335|ADHP_ECOLI|e-160|92.8|335/336| GO:SWS:NREP 3 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 57->71|PS00059|ADH_ZINC|PDOC00058| SEG 225->241|ktggahaavvtavakaa| SEG 245->259|avdavraggrvvavg| BL:PDB:NREP 1 BL:PDB:REP 1->332|1rjwA|6e-82|49.8|331/339| RP:PDB:NREP 1 RP:PDB:REP 1->335|2cf5A|3e-48|23.5|332/352| RP:PFM:NREP 2 RP:PFM:REP 25->126|PF08240|5e-20|48.5|101/108|ADH_N| RP:PFM:REP 172->224|PF00107|1e-06|46.2|52/128|ADH_zinc_N| HM:PFM:NREP 2 HM:PFM:REP 25->131|PF08240|2.2e-33|45.3|106/109|ADH_N| HM:PFM:REP 172->298|PF00107|2.6e-31|40.5|126/130|ADH_zinc_N| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08240|IPR013154| GO:PFM GO:0008270|"GO:zinc ion binding"|PF00107|IPR013149| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00107|IPR013149| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00107|IPR013149| RP:SCP:NREP 2 RP:SCP:REP 1->182|1kolA1|2e-35|20.9|177/201|b.35.1.2| RP:SCP:REP 156->216|1a9xA3|7e-08|9.8|61/127|c.30.1.1| HM:SCP:REP 1->179|1jqbA1|7.1e-52|41.3|167/0|b.35.1.2|1/1|GroES-like| HM:SCP:REP 134->303|1d1tA2|1.2e-42|38.8|170/0|c.2.1.1|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 5875 OP:NHOMOORG 975 OP:PATTERN 11212-5ADDDECFE91653242-B1124262-1----------3---1-221-11121114331-44 77D-83264471127BA66-6H33CR878888FIJJBIRN1A69G5761421F9H634112486A3JHFC61111131---2A11111--11-2-----2-4-4-92433--------------221-1-111--115532111376346332--11---11-122677B11----1------54322431728333334562473446A65566434442293333333235233343343433334345451-4--2-6--14455213123362223221222211322323234332222222223222322441222222-15332232322274--1-1---21-1-1--112141211221121-373673351----77ACE5-78756744554554447-A745A768688-DFF9HEIFGDBH683534365367645444444445764-132-----111-----------------1-11-3A63223333DABCDGB7577EEEE888827BDG5B87--22A53364834247413-22122213223231661-312---1---1----45412232145C67A341----1111111112111-1-----3422233442B523211223321113242122---12--------5966246DAACDCBCCC-ACCBDBCCABACCDDCDD789958432A7C6B9DAADC6A66A865677581-344443444444---3111114333213781115-3-1221-22-445461512-B186983857467667877111212111-2112111-12112245768654444222---3332233--------1--------31--1-------2------1211122333252 --11875-21--259ORRRRTXQeieWFFACAB9A8CC8A9B9876KJKWUSwoILFFBCCC8AG496886667E7B89A79989876-IeFR7H6HED9A4ACAE-536L6748954214242772J1HjA-C7H4332523743421234394B37B6841A734349546294763742445EENVMFK33VPMF5 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 336 STR:RPRED 100.0 SQ:SECSTR EEEEEEccTTccEEEEEEcccccTTEEEEEEEEEEEcHHHHHHHTcTTTcccccccccEEEEEEEEEccccccccTTcEEEEccEEEcccccHHHHTTcGGGcTTcEETcccccccccccEEEEGGGEEEccccccHHHHTGGGTHHHHHHHHHHHTcTTcTTcEEEEcccHHHHHHHHHHHHHTcEEEEEEccTTHHHHHHTTcccccEEETTcHHHHHHcTTTEEEEEEcccccccHHHcHHHHTTEEEEEEEEEcccccccccccHHHHHHHTcEEEEcccccHHHHHHHHHHHHHTTccccEEEEEGGGHHHHHHHHHTTccccEEEEETTc PSIPRED cEEEEEEccccEEEEEEEcccccccEEEEEEEEEEEEccEEEEEEccccccccEEccccccEEEEEEcccccccccccEEEEEcccccccccHHHccccccccccccccccccccccEEEEEEcHHHEEEccccccHHHHHccccHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHcccEEEEcccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHccccEEEEEcccccccEEcHHHHHHccEEEEEEEEccHHHHHHHHHHHHHcccccEEEEEEHHHHHHHHHHHHccccEEEEEEEEcc //