[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66958.1
DDBJ      :             conserved domain protein
Swiss-Prot:YQAE_ECOLI   RecName: Full=UPF0057 membrane protein yqaE;

Homologs  Archaea  0/68 : Bacteria  90/915 : Eukaryota  50/199 : Viruses  0/175   --->[See Alignment]
:52 amino acids
:PSIPRED
:RPS:PFM   5->48 PF01679 * UPF0057 2e-07 63.6 %
:HMM:PFM   3->49 PF01679 * UPF0057 9.3e-23 55.3 47/51  
:BLT:SWISS 1->51 YQAE_ECOLI 1e-25 94.1 %
:PROS 7->22|PS01309|UPF0057
:TM
:REPEAT 2|2->20|22->41

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66958.1 GT:GENE ACF66958.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2920211..2920369) GB:FROM 2920211 GB:TO 2920369 GB:DIRECTION - GB:PRODUCT conserved domain protein GB:NOTE identified by match to protein family HMM PF01679 GB:PROTEIN_ID ACF66958.1 GB:DB_XREF GI:194406739 LENGTH 52 SQ:AASEQ MGFWRIVFTIILPPLGVLLGKGFGWAFILNILLTLLGYIPGLIHAFWVQMRH GT:EXON 1|1-52:0| SW:ID YQAE_ECOLI SW:DE RecName: Full=UPF0057 membrane protein yqaE; SW:GN Name=yqaE; OrderedLocusNames=b2666, JW2641; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->51|YQAE_ECOLI|1e-25|94.1|51/52| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 7->22|PS01309|UPF0057|PDOC01013| TM:NTM 2 TM:REGION 2->24| TM:REGION 29->51| NREPEAT 1 REPEAT 2|2->20|22->41| RP:PFM:NREP 1 RP:PFM:REP 5->48|PF01679|2e-07|63.6|44/51|UPF0057| HM:PFM:NREP 1 HM:PFM:REP 3->49|PF01679|9.3e-23|55.3|47/51|UPF0057| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF01679|IPR000612| OP:NHOMO 142 OP:NHOMOORG 140 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------1----------------------------------------------------------------11---1--------------1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----111----1--------11----------------------11------------------------------------------------------------------------------------------------------------1111-1-------------------------------------------------------1----1------1---------------------------1-1-1-1111111-11-1111111111111111111111-1---11111111111111111111-1111------------------------------1-------------------------------11-----111---------------------------------------------------------------------------------------------------- ---------------1-1--1111--1111111---1111-11111111111111-1-11------------1------------1-1-1-1--11111-11--12----------------------------------------------------------------------1------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHEEc //