[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67034.1
DDBJ      :             extensin family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  113/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.65.1
:227 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  111->227 1lbuA2  d.65.1.1 * 1e-05 20.0 %
:RPS:PFM   52->227 PF06904 * Extensin-like_C 6e-35 49.4 %
:HMM:PFM   53->227 PF06904 * Extensin-like_C 1.5e-57 44.5 173/179  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67034.1 GT:GENE ACF67034.1 GT:PRODUCT extensin family protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 481880..482563 GB:FROM 481880 GB:TO 482563 GB:DIRECTION + GB:PRODUCT extensin family protein GB:NOTE identified by match to protein family HMM PF06904 GB:PROTEIN_ID ACF67034.1 GB:DB_XREF GI:194406815 LENGTH 227 SQ:AASEQ MRGKGFLIIVLLGGIGGLGYRYLPSYYNPFAPLQLADPPGWITTFKLQRLTPSQCRELLTAANQQGLISSQPVADSAGECPLSHVVRVRDFGLVKLSSSFLASCPLALRSALFVEQQAKPLTETWMKRRLTRIEHLGSYACRNIYHRPDARRSEHASAEALDVSGFQLSDGRKITVLRGWGREETGPWLRAMLNASCHYYGNGLGPDYNAAHANHFHLGMRGYGVCR GT:EXON 1|1-227:0| TM:NTM 1 TM:REGION 4->26| SEG 3->19|gkgfliivllggigglg| RP:PFM:NREP 1 RP:PFM:REP 52->227|PF06904|6e-35|49.4|174/179|Extensin-like_C| HM:PFM:NREP 1 HM:PFM:REP 53->227|PF06904|1.5e-57|44.5|173/179|Extensin-like_C| RP:SCP:NREP 1 RP:SCP:REP 111->227|1lbuA2|1e-05|20.0|95/130|d.65.1.1| OP:NHOMO 144 OP:NHOMOORG 113 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-----111222221221111221222222-221111222-1-21111222222212-1-11-1111111---------11--1-1------------------------------21121--------------------------------------------1--1-----------------------------------------------------------------------------------------------------------------------------11---1-------------------------------11111---1111111111111111--------------------------------------1--------------------------1-1111-111111111111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,75-77,147-151,227-228| PSIPRED cccccHHHHHHHHHHccccEEccccccccccccccccccccccccccccccHHHHHHHHHHcccEEEEcccccccccccccccccEEEEEEcccEEcccEEEEHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccEEEEEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHcccccccccccccHHHHccEEEccccccccc //