[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67048.1
DDBJ      :             packaged DNA stabilization protein gp10
Swiss-Prot:VG10_BPP22   RecName: Full=Packaged DNA stabilization protein gp10;

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  4/175   --->[See Alignment]
:472 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   25->404 PF11134 * Phage_stabilise e-165 77.4 %
:HMM:PFM   4->472 PF11134 * Phage_stabilise 2.8e-261 69.7 468/468  
:BLT:SWISS 1->472 VG10_BPP22 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67048.1 GT:GENE ACF67048.1 GT:PRODUCT packaged DNA stabilization protein gp10 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 403022..404440 GB:FROM 403022 GB:TO 404440 GB:DIRECTION + GB:PRODUCT packaged DNA stabilization protein gp10 GB:PROTEIN_ID ACF67048.1 GB:DB_XREF GI:194406829 LENGTH 472 SQ:AASEQ MPIQQLPMMKGMGKDFKNADYIDYLPVNMLATPKEILNSSGYLRSFPGITKRYDMNGVSRGVEYNTAQNAVYRVCGGKLYKGESEVGDVAGSGRVSMAHGRTSQAVGVNGQLVEYRYDGTVKTVSNWPADSGFTQYELGSVRDITRLRGRYAWSKDGTDSWFITDLEDESHPDRYSAQYRAESQPDGIIGIGTWRDFIVCFGSSTIEYFSLTGATTAGAALYVAQPSLMVQKGIAGTYCKTPFADSYAFISHPATGAPSVYIIGSGQASPIATASIEKIIRSYTAEEMATGVMETLRFDSHELLIIHLPRHVLVYDASSSQNGPQWCVLKTGLYDDVYRGVDFMYEGNQITCGDKSEAVVGQLQFDISSQYDKQQEHLLFTPLFKADNARCFDLEVESSTGVAQYADRLFLSATTDGINYGREQMIEQNEPFVYDKRVLWKRVGRIRRLIGFKLRVITKSPVTLSGCQIRLE GT:EXON 1|1-472:0| SW:ID VG10_BPP22 SW:DE RecName: Full=Packaged DNA stabilization protein gp10; SW:GN Name=10; SW:KW Late protein. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->472|VG10_BPP22|0.0|100.0|472/100| SEG 212->220|tgattagaa| RP:PFM:NREP 1 RP:PFM:REP 25->404|PF11134|e-165|77.4|371/397|Phage_stabilise| HM:PFM:NREP 1 HM:PFM:REP 4->472|PF11134|2.8e-261|69.7|468/468|Phage_stabilise| OP:NHOMO 22 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-11---------1-1------1---------1-11---1-1----1----111-----------------1------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------1------------1------1------------------------------------1----------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccEEcHHHHHHccccccccHHHHccccccccHHHHHcccccEEEccccEEEccccccccccEEccccccEEEEEccEEEEEEccccccccccEEEEEcccEEEEEEEccEEEEEEEcccHHccccccccccccccccccEEEEEEcccEEEEEcccccEEEEEEcccccccccccccccccccccEEEEEEEEEEEEEEEEcccEEEEEEEcccccccccEEEcccccHHHHHHccccEEEEccEEEEEEcccccccEEEEEccccccEEccHHHHHHHHccccHHHHHHHHHEEEEccEEEEEEEEccccEEEEEEccccccEEEEEccccccccEEEEEEEEEccEEEEEEccccEEEEEEEEcccccccEEEEEEEEEEEccccEEEEEEEEEEccccccccEEEEEEEEccccccHHHHHHHcccccEEEEEEEEEEEEEEccccEEEEEEEEcccEEEcccEEEEc //