[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67052.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:278 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   63->96 1l5sB PDBj 6e-04 47.1 %
:BLT:SWISS 158->217 MUG2_MOUSE 5e-04 36.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67052.1 GT:GENE ACF67052.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1808313..1809149) GB:FROM 1808313 GB:TO 1809149 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF67052.1 GB:DB_XREF GI:194406833 LENGTH 278 SQ:AASEQ MSKHNLIIYSLLLAAAPISVLADSSTTSAATVGMFSPPTAPSVGHRPKKPRVVFQFVNEKGQALVYDTDYAPVSGTTLNKYLLWDARDPDTDYFQASETSTMTCTYYLVNRDGSQHKVKREKPCEYRFDFKEEHVGSKLKLELYNETDMASASGYTPVPTVSAPFYVETKVIVNMPPDLAIVDIDKPVLLPGESAIVKLIFKDKDNNPINDLEIMRYRDYNHGGEWDISFVKKGSNPGEYIHTVTYKGANGSRDPKVFLEYKHLGVFLLSKKIMITGK GT:EXON 1|1-278:0| BL:SWS:NREP 1 BL:SWS:REP 158->217|MUG2_MOUSE|5e-04|36.7|60/1451| TM:NTM 1 TM:REGION 3->25| BL:PDB:NREP 1 BL:PDB:REP 63->96|1l5sB|6e-04|47.1|34/791| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 34 STR:RPRED 12.2 SQ:SECSTR ##############################################################EEEEEEEEEccccccEEEEEEEEEEcccccHHHH###################################################################################################################################################################################### DISOP:02AL 1-3,277-279| PSIPRED ccccEEEHHHHHHHHccEEEEEcccccccEEEEEEcccccccccccccccEEEEEEEcccccEEEEEEEEccccccccHHHHHccccccccccccccccEEEEEEEEEEcccccEEEEccccccccEEccHHcccccEEEEEEEccccccccccccccccccccEEEEEEEEEcccccEEEEEcccccccccccEEEEEEEEEcccccccEEEEEEEEEccccccEEEEEEEcccccccEEEEEEEEccccccccEEEEEEEEcccEEEEEEEEEEcc //