[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67074.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:YBEY_SALTI   RecName: Full=Putative metalloprotease ybeY;         EC=3.4.24.-;

Homologs  Archaea  0/68 : Bacteria  686/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
d.92.1
:157 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->152 1xm5A PDBj 3e-66 75.7 %
:RPS:SCOP  1->152 1xm5A  d.92.1.15 * 6e-56 86.2 %
:HMM:SCOP  1->152 1xm5A_ d.92.1.15 * 2.5e-50 45.4 %
:RPS:PFM   37->145 PF02130 * UPF0054 3e-24 56.0 %
:HMM:PFM   22->144 PF02130 * UPF0054 2e-45 43.9 123/145  
:BLT:SWISS 1->157 YBEY_SALTI 2e-90 100.0 %
:PROS 114->124|PS01306|UPF0054

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67074.1 GT:GENE ACF67074.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(781182..781655) GB:FROM 781182 GB:TO 781655 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF02130; match to protein family HMM TIGR00043 GB:PROTEIN_ID ACF67074.1 GB:DB_XREF GI:194406855 LENGTH 157 SQ:AASEQ MSQVILDLQLACENHAGLPDEAQFQRWLDGVIPQFQEEAEVTIRLVDEAESHDLNLTYRGKDKPTNVLSFPFEAPPGIEMPLLGDLIICRQVVEQEAQEQSKPLEAHWAHMVVHGSLHLLGYDHIDDDEAEEMESLETEIMLAMGYEDPYIAEKIAE GT:EXON 1|1-157:0| SW:ID YBEY_SALTI SW:DE RecName: Full=Putative metalloprotease ybeY; EC=3.4.24.-; SW:GN Name=ybeY; OrderedLocusNames=STY0714, t2205; SW:KW Complete proteome; Hydrolase; Metal-binding; Metalloprotease;Protease; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->157|YBEY_SALTI|2e-90|100.0|157/157| GO:SWS:NREP 4 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008237|"GO:metallopeptidase activity"|Metalloprotease| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| PROS 114->124|PS01306|UPF0054|PDOC01010| BL:PDB:NREP 1 BL:PDB:REP 1->152|1xm5A|3e-66|75.7|152/152| RP:PFM:NREP 1 RP:PFM:REP 37->145|PF02130|3e-24|56.0|109/142|UPF0054| HM:PFM:NREP 1 HM:PFM:REP 22->144|PF02130|2e-45|43.9|123/145|UPF0054| GO:PFM:NREP 2 GO:PFM GO:0008237|"GO:metallopeptidase activity"|PF02130|IPR002036| GO:PFM GO:0008270|"GO:zinc ion binding"|PF02130|IPR002036| RP:SCP:NREP 1 RP:SCP:REP 1->152|1xm5A|6e-56|86.2|152/152|d.92.1.15| HM:SCP:REP 1->152|1xm5A_|2.5e-50|45.4|152/0|d.92.1.15|1/1|Metalloproteases ("zincins"), catalytic domain| OP:NHOMO 702 OP:NHOMOORG 696 OP:PATTERN -------------------------------------------------------------------- -1---111111-1--11-----111------1--------1111---1---1----------1-------1-111---1-1-11111--------------1----------------------1-----------111-1--1--1111111111111111-11111111-1-----1------1--11-111--------1------111111---11111111111111-1111111111111111111111111111111111111111-1111111111111111111111111111111111111111-11111111111--1111111---11111111-1111111111111111--111-1111-11-11111111111111111111111111111111-11111111111111111111111111111111-1--11111111111-111-11-11111111111111--1111111111111-1-111111111111111111111111111111111111111111111111111111111111111111111111111-111-----------1----1---1---1---1111111111-11--111--1---111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111112221111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111-----11-111---1--11-------1-11----11--11111--- ----------------------------------------------------------------------------------------------------------------1-11------------------------------------------------------4--1--1--------11-----1-1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 96.8 SQ:SECSTR ccEEEEEEEEccccccccccHHHHHHHHHTTcHHHHcEEEEEEEEEcHHHHHHHHHHHHcccccccEEEEEccccccccccEEEEEEEEHHHHHHHHHHTTccHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHTTccccccc##### DISOP:02AL 1-1,152-158| PSIPRED cccEEEEEEEEcccccccccHHHHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHHcccccccEEEEcccccccccccccccEEEEEHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccHHHHccc //