[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67087.1
DDBJ      :             inner membrane protein YbhL
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  425/915 : Eukaryota  63/199 : Viruses  0/175   --->[See Alignment]
:237 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   20->231 PF01027 * UPF0005 4e-29 47.0 %
:HMM:PFM   20->231 PF01027 * UPF0005 1.5e-36 35.4 195/203  
:BLT:SWISS 1->234 YBHL_ECOLI e-105 81.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67087.1 GT:GENE ACF67087.1 GT:PRODUCT inner membrane protein YbhL GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 921628..922341 GB:FROM 921628 GB:TO 922341 GB:DIRECTION + GB:PRODUCT inner membrane protein YbhL GB:NOTE identified by match to protein family HMM PF01027 GB:PROTEIN_ID ACF67087.1 GB:DB_XREF GI:194406868 LENGTH 237 SQ:AASEQ MDRFPRSDSIVQARSGLQTYMAQVYGWMTVGLLLTAFIAWYAANTPAVMMFVFSSKITFFGLIIAQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTFVVTGGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVVVFVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGKVRTSS GT:EXON 1|1-237:0| BL:SWS:NREP 1 BL:SWS:REP 1->234|YBHL_ECOLI|e-105|81.2|234/234| TM:NTM 6 TM:REGION 51->73| TM:REGION 83->105| TM:REGION 107->128| TM:REGION 138->160| TM:REGION 165->187| TM:REGION 210->232| RP:PFM:NREP 1 RP:PFM:REP 20->231|PF01027|4e-29|47.0|198/200|UPF0005| HM:PFM:NREP 1 HM:PFM:REP 20->231|PF01027|1.5e-36|35.4|195/203|UPF0005| OP:NHOMO 555 OP:NHOMOORG 488 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------1111111----------------11-------------111111111111111------1---11------------------------------1----------------111-----1-------------------------------------------------------------1-11111121211221111111111111111111111111111111111111111111111111111111---1--------------------------------------------11---211411111112121111111111111111111-1121121112112112221222111111121122221111111111111111111111111111111111111111111111111112111---11121111111111111111111211111--11111111-1--1-1----------------------11111111111111111----1111-1---11111111111-111111111111-211------1-11-1-----1----------1--------------11111111112122211-1112112222121111112111111112122212222212122111111111-111112111111111-11111------------------------------------1111-----------------------------------------------------1-------11111111-------------------1--------------------- ------1-1-----11--1-------1------1111----------11-1111---11---11----------------------11------1----1-1-11--1-1211--12----11111---271---211112--111--1---------111---11--1----21-12-----------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,234-238| PSIPRED cccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //