[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67096.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  60/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:50 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->29 PF06945 * DUF1289 1.4e-09 37.9 29/56  
:BLT:SWISS 2->50 YDHL_ECOL6 5e-20 77.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67096.1 GT:GENE ACF67096.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1561991..1562143 GB:FROM 1561991 GB:TO 1562143 GB:DIRECTION + GB:PRODUCT conserved domain protein GB:PROTEIN_ID ACF67096.1 GB:DB_XREF GI:194406877 LENGTH 50 SQ:AASEQ MRSRDERFNWQKMSDVEKQNVLRLCRQRFLRKIRANKPLPSEDPQQPSLF GT:EXON 1|1-50:0| BL:SWS:NREP 1 BL:SWS:REP 2->50|YDHL_ECOL6|5e-20|77.6|49/79| HM:PFM:NREP 1 HM:PFM:REP 1->29|PF06945|1.4e-09|37.9|29/56|DUF1289| OP:NHOMO 60 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1-1111111-----11111-1-111-11111-1111111-1-11111111111111-1-11111---1-111--1111--------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,30-51| PSIPRED cccHHHHHcHHcccHHHHHHHHHHHHHHHHHHHHccccccccHHHccccc //