[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67102.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.247.1
:50 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->50 2jn8A PDBj 1e-25 98.0 %
:HMM:SCOP  1->50 2es9A1 a.247.1.1 * 7.5e-25 84.0 %
:RPS:PFM   2->50 PF08986 * DUF1889 4e-17 75.5 %
:HMM:PFM   2->50 PF08986 * DUF1889 2.1e-24 71.4 49/119  
:BLT:SWISS 2->50 YOAC_SHIFL 7e-18 69.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67102.1 GT:GENE ACF67102.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 418036..418188 GB:FROM 418036 GB:TO 418188 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF67102.1 GB:DB_XREF GI:194406883 LENGTH 50 SQ:AASEQ MARGEQEGWNPEFTKKVAGWAEKVASGNRILIKNPEYFSTYMQEQLKELV GT:EXON 1|1-50:0| BL:SWS:NREP 1 BL:SWS:REP 2->50|YOAC_SHIFL|7e-18|69.4|49/119| BL:PDB:NREP 1 BL:PDB:REP 1->50|2jn8A|1e-25|98.0|50/109| RP:PFM:NREP 1 RP:PFM:REP 2->50|PF08986|4e-17|75.5|49/99|DUF1889| HM:PFM:NREP 1 HM:PFM:REP 2->50|PF08986|2.1e-24|71.4|49/119|DUF1889| HM:SCP:REP 1->50|2es9A1|7.5e-25|84.0|50/0|a.247.1.1|1/1|YoaC-like| OP:NHOMO 48 OP:NHOMOORG 48 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-111111111--1111111111111111111111-----1-1-1-11111-1--1-1--1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 50 STR:RPRED 100.0 SQ:SECSTR HHHHHHHTccHHHHHHHHHHHHHHHHTcccccccGGGccHHHHHHHHHHH DISOP:02AL 1-6| PSIPRED ccccHHccccHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHc //