[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67106.1
DDBJ      :             outer membrane porin protein LC
Swiss-Prot:OMPD_SALTY   RecName: Full=Outer membrane porin protein ompD;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  128/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.4.3
:362 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->362 1osmA PDBj e-129 68.6 %
:RPS:PDB   22->362 1bt9A PDBj 2e-25 63.8 %
:RPS:SCOP  22->362 1bt9A  f.4.3.1 * e-101 64.7 %
:HMM:SCOP  22->362 1osmA_ f.4.3.1 * 2.3e-88 33.8 %
:RPS:PFM   49->341 PF00267 * Porin_1 3e-34 40.4 %
:HMM:PFM   27->362 PF00267 * Porin_1 8.6e-143 64.3 328/336  
:BLT:SWISS 20->362 OMPD_SALTY 0.0 100.0 %
:PROS 314->330|PS00576|GRAM_NEG_PORIN
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67106.1 GT:GENE ACF67106.1 GT:PRODUCT outer membrane porin protein LC GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1704021..1705109 GB:FROM 1704021 GB:TO 1705109 GB:DIRECTION + GB:PRODUCT outer membrane porin protein LC GB:NOTE identified by match to protein family HMM PF00267 GB:PROTEIN_ID ACF67106.1 GB:DB_XREF GI:194406887 LENGTH 362 SQ:AASEQ MKLKLVAVAVTSLLAAGVVNAAEVYNKDGNKLDLYGKVHAQHYFSDDNGSDGDKTYARLGFKGETQINDQLTGFGQWEYEFKGNRTESQGADKDKTRLAFAGLKFADYGSFDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTGRTTGVATYRNTDFFGLVEGLNFAAQYQGKNDRDGAYESNGDGFGLSATYEYEGFGVGAAYAKSDRTNNQVKAASNLNAAGKNAEVWAAGLKYDANNIYLATTYSETLNMTTFGEDAAGDAFIANKTQNFEAVAQYQFDFGLRPSIAYLKSKGKNLGTYGDQDLVEYIDVGATYYFNKNMSTFVDYKINLLDDSDFTKAAKVSTDNIVAVGLNYQF GT:EXON 1|1-362:0| SW:ID OMPD_SALTY SW:DE RecName: Full=Outer membrane porin protein ompD;Flags: Precursor; SW:GN Name=ompD; Synonyms=nmpC; OrderedLocusNames=STM1572; SW:KW Cell membrane; Cell outer membrane; Complete proteome; Ion transport;Membrane; Porin; Signal; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 20->362|OMPD_SALTY|0.0|100.0|343/362| GO:SWS:NREP 8 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0009279|"GO:cell outer membrane"|Cell outer membrane| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0015288|"GO:porin activity"|Porin| GO:SWS GO:0046930|"GO:pore complex"|Porin| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 314->330|PS00576|GRAM_NEG_PORIN|PDOC00498| TM:NTM 1 TM:REGION 4->25| SEG 3->19|lklvavavtsllaagvv| BL:PDB:NREP 1 BL:PDB:REP 22->362|1osmA|e-129|68.6|331/342| RP:PDB:NREP 1 RP:PDB:REP 22->362|1bt9A|2e-25|63.8|334/340| RP:PFM:NREP 1 RP:PFM:REP 49->341|PF00267|3e-34|40.4|285/306|Porin_1| HM:PFM:NREP 1 HM:PFM:REP 27->362|PF00267|8.6e-143|64.3|328/336|Porin_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00267|IPR001702| GO:PFM GO:0006810|"GO:transport"|PF00267|IPR001702| GO:PFM GO:0016020|"GO:membrane"|PF00267|IPR001702| RP:SCP:NREP 1 RP:SCP:REP 22->362|1bt9A|e-101|64.7|334/340|f.4.3.1| HM:SCP:REP 22->362|1osmA_|2.3e-88|33.8|331/0|f.4.3.1|1/1|Porins| OP:NHOMO 514 OP:NHOMOORG 128 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1------2------------------------------1------------------------------------------------------------------------331-------2111211-2211112111---------1--11164224644887577776-4658657766677644557555112217866777777757577465387762-433446444454111-------------1-------------------------------------------------------33242222264224------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 343 STR:RPRED 94.8 SQ:SECSTR ###################ETcEEEEETTEEEEEEEEEEEEEEEcccccTcEEccEEEEEEEEEEEEETTEEEEEEEEEEEccccccTTTTTTcEEEEEEEEEEETTTEEEEEEEEEcTTHHHHGGGccccccccTTccTcTcTTccEEEEEEEEEEEHHHHTcTTEEEEEEEEcccccccGGGccccEEEEEEEEEETTEEEEEEEEEEEccHHHHcEETcccccccEEEEEEEEEEEEETTEEEEEEEEEEEcccEEEETTTTEEEEccEEEEEEEEEEEccTTcEEEEEEEEEEEEEEETTTEEEEEEEEEEEEEEEEccccEEEEEEEEEEcccTTcTTcccccccccEEEEEEEEEc DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHccccEEEEEEccccEEEEEEEEEEEEEEEcccccccccccEEEEEEEEEEEcccEEEEEEEEEEEEEcccccccccccccEEEEEEEEcccEEEEEEEEEEcHHHHHHHHHcccccccccccccccccccccEEEEEEEEccccccEEEEEEEEEEEcccccccccccccccEEEEEEEEEcccEEEEEEEEccccccccccccccccccccEEEEEEEEEEEEEccEEEEEEEEEEEEcccccccccccccccccEEEEEEEEEEEEcccEEEEEEEEEEEEEEcccccccccEEEEEEEEEEEccccEEEEEEEEEEEccccccEEccccccccEEEEEEEEEc //