[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67167.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  64/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.38.1
:76 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->72 2ra2F PDBj 3e-10 59.1 %
:RPS:PDB   22->71 3bduB PDBj 2e-08 50.0 %
:RPS:SCOP  24->76 2ra2A1  b.38.1.6 * 2e-11 53.8 %
:RPS:PFM   24->73 PF06004 * DUF903 8e-07 61.2 %
:HMM:PFM   24->74 PF06004 * DUF903 4.8e-25 56.0 50/50  
:HMM:PFM   1->45 PF05481 * Myco_19_kDa 4.1e-05 27.9 43/160  
:BLT:SWISS 21->75 YGDI_ECOLI 2e-14 63.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67167.1 GT:GENE ACF67167.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 88875..89105 GB:FROM 88875 GB:TO 89105 GB:DIRECTION + GB:PRODUCT conserved domain protein GB:NOTE identified by match to protein family HMM PF06004 GB:PROTEIN_ID ACF67167.1 GB:DB_XREF GI:194406948 LENGTH 76 SQ:AASEQ MQKRLMTALFTAATLFTVAGCSSNQAVETTDGKTIVTDGKPEVDNDTGMVSYKNAATGKTEQINRDQLKNMSELDN GT:EXON 1|1-76:0| BL:SWS:NREP 1 BL:SWS:REP 21->75|YGDI_ECOLI|2e-14|63.0|54/75| SEG 7->19|talftaatlftva| BL:PDB:NREP 1 BL:PDB:REP 27->72|2ra2F|3e-10|59.1|44/50| RP:PDB:NREP 1 RP:PDB:REP 22->71|3bduB|2e-08|50.0|48/50| RP:PFM:NREP 1 RP:PFM:REP 24->73|PF06004|8e-07|61.2|49/50|DUF903| HM:PFM:NREP 2 HM:PFM:REP 24->74|PF06004|4.8e-25|56.0|50/50|DUF903| HM:PFM:REP 1->45|PF05481|4.1e-05|27.9|43/160|Myco_19_kDa| RP:SCP:NREP 1 RP:SCP:REP 24->76|2ra2A1|2e-11|53.8|52/53|b.38.1.6| OP:NHOMO 146 OP:NHOMOORG 64 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------32-1-332222222-22-222222222222222222234311--1333333333333333322222222--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 54 STR:RPRED 71.1 SQ:SECSTR #####################ccEEEEEETTccEEEEEcccEEcTTTcEEEEcccTTccEEEEcGGGEEEEEccc# DISOP:02AL 1-4,74-77| PSIPRED ccHHHHHHHHHHHHHHHHHcccccEEEEEEcccEEEEcccccEEcccccEEEEEcccccEEEEcHHHHHHHHHHcc //