[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67190.1
DDBJ      :             tRNA-dihydrouridine synthase C
Swiss-Prot:DUSC_SALTY   RecName: Full=tRNA-dihydrouridine synthase C;         EC=1.-.-.-;

Homologs  Archaea  5/68 : Bacteria  840/915 : Eukaryota  188/199 : Viruses  0/175   --->[See Alignment]
c.1.4
:312 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   60->242 1vhnA PDBj 3e-21 34.1 %
:RPS:PDB   4->299 3c52B PDBj 5e-37 8.7 %
:RPS:SCOP  1->309 1vhnA  c.1.4.1 * 9e-59 25.9 %
:HMM:SCOP  1->311 1vhnA_ c.1.4.1 * 4.7e-69 40.2 %
:RPS:PFM   5->276 PF01207 * Dus 1e-45 44.3 %
:HMM:PFM   5->279 PF01207 * Dus 1e-96 45.5 266/310  
:BLT:SWISS 1->312 DUSC_SALTY e-180 99.0 %
:PROS 92->110|PS01136|UPF0034

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67190.1 GT:GENE ACF67190.1 GT:PRODUCT tRNA-dihydrouridine synthase C GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2318312..2319250) GB:FROM 2318312 GB:TO 2319250 GB:DIRECTION - GB:PRODUCT tRNA-dihydrouridine synthase C GB:NOTE identified by match to protein family HMM PF01207 GB:PROTEIN_ID ACF67190.1 GB:DB_XREF GI:194406971 LENGTH 312 SQ:AASEQ MRVLLAPMEGVLDALVRELLTEVNDYDLCITEFVRVVDQLLPVKVFHRICPELHHASRTPSGTPVRIQLLGQHPQWLAENAARATALGSYGVDLNCGCPSKVVNGSGGGATLLKDPELIYQGAKAMRAAVPSHLPVTVKVRLGWDSGDRKFEIADAVQQAGASELVVHGRTKAQGYRAEHIDWQAIGEIRQRLTIPVIANGEIWDWQSAQACMATSGCDAVMIGRGALNIPNLSRVVKYNEPRMPWPEVVTLLQKYTRLEKQGDTGLYHVARIKQWLGYLRKEYIEAIELFQSIRALNRSSEIARVIQAIKI GT:EXON 1|1-312:0| SW:ID DUSC_SALTY SW:DE RecName: Full=tRNA-dihydrouridine synthase C; EC=1.-.-.-; SW:GN Name=dusC; OrderedLocusNames=STM2174; SW:KW Complete proteome; FAD; Flavoprotein; Oxidoreductase; tRNA processing. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->312|DUSC_SALTY|e-180|99.0|312/312| GO:SWS:NREP 3 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| PROS 92->110|PS01136|UPF0034|PDOC00874| BL:PDB:NREP 1 BL:PDB:REP 60->242|1vhnA|3e-21|34.1|176/299| RP:PDB:NREP 1 RP:PDB:REP 4->299|3c52B|5e-37|8.7|287/295| RP:PFM:NREP 1 RP:PFM:REP 5->276|PF01207|1e-45|44.3|262/303|Dus| HM:PFM:NREP 1 HM:PFM:REP 5->279|PF01207|1e-96|45.5|266/310|Dus| GO:PFM:NREP 4 GO:PFM GO:0008033|"GO:tRNA processing"|PF01207|IPR001269| GO:PFM GO:0017150|"GO:tRNA dihydrouridine synthase activity"|PF01207|IPR001269| GO:PFM GO:0050660|"GO:FAD binding"|PF01207|IPR001269| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01207|IPR001269| RP:SCP:NREP 1 RP:SCP:REP 1->309|1vhnA|9e-59|25.9|294/305|c.1.4.1| HM:SCP:REP 1->311|1vhnA_|4.7e-69|40.2|296/305|c.1.4.1|1/1|FMN-linked oxidoreductases| OP:NHOMO 2125 OP:NHOMOORG 1033 OP:PATTERN -------------------------------------------------1111--------------1 111-11-11111111-111-11111111111111111111----11111111111111--1111111111-11111111111-1----222211111--111111211111111111111111121111111111111111---1-221122211222222222211222122122222221222111--11122222222222222221-1122222-1131221111111211111111111111111111211111111113311111111111111111111111111111111111111111111111111111111111212222222222211112122111111111111111111111111-111-2222211111222122222222222222222222-11111211222-22222222222222222222222222211111111111111121111111111111111111-1111111111111112222222222222222223222222222333322233332333233322222111133333333311112232323222112222122212122211112111111111111111111111111111111333333323333333333333333333333--21212--1---33333333333333333-3333333333333333333333333333333333333333333322333331-333333333333--1211111222223222333333323323333333333333233333333333333333332222222222333334332233332221211222----1-11332222---1-111111----1---1--------1-------1111-11111-22 1211556-523-334332212221222222222222122222222212111111-131111-43333323324343212234433434-36334445444215563148473744441-1-14163-218L4-438121-41342243126114155345883634-433443342557j6774364652446344442 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 312 STR:RPRED 100.0 SQ:SECSTR cTTccccHHHHHHcHHHHHTccEEEEEcccHHHHHHHHHHHHHHHTccEEEEEEHHHHcHHHHHHHHHHHHHHcTTccEEEEEEEEccHHHHHHHHHHTccEEEEccTTccHHHHHHHHHHTHHHHHHHHHTTcEEEEEEcccccccccHHHHHHHHHHHcccEEEEcccccccccccccccHHHHHHHHHHHcccEEEcccccccHHHHHHHccHHTTcccTTcccccHHHHHHHHHHTEEEEEEcHHHHHHHHHHHHHHHHHcTTcccHHHHHHHHHHHHHHHHHHHHHHHHTcTTcTTTTTcTTTGGEc PSIPRED cEEEEcccccccHHHHHHHHHHHccccEEEEccEEEHHHHcccHHHcccHHHHHHHccccccccEEEEEEcccHHHHHHHHHHHHHccccEEEEccccccHHHccccccHHHHccHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEccccHHccccccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHccccEEEEcHHHHccccHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHHcc //