[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67230.1
DDBJ      :             putative regulator protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.64.1
:180 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   56->126 1h5yB PDBj 4e-04 26.8 %
:RPS:PDB   18->172 2avuE PDBj 5e-10 20.8 %
:RPS:SCOP  18->172 2avuE1  e.64.1.1 * 3e-10 20.8 %
:RPS:PFM   34->172 PF05280 * FlhC 3e-07 37.2 %
:HMM:PFM   29->173 PF05280 * FlhC 2.9e-09 21.6 134/176  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67230.1 GT:GENE ACF67230.1 GT:PRODUCT putative regulator protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1549128..1549670 GB:FROM 1549128 GB:TO 1549670 GB:DIRECTION + GB:PRODUCT putative regulator protein GB:PROTEIN_ID ACF67230.1 GB:DB_XREF GI:194407011 LENGTH 180 SQ:AASEQ MEKSTDYKSGWLGRWIAARHMALAGYITKIIMIETGLTYKQVRRLYQDIENDGYELERRSRTFRGGATLIHSHTSKIQASLLMQLYRNIGGEDVIRSIDIKALNKAFRMYHAIRKEVPGMKGARWAPFDITDAWCLASELRCGDAMLEECGNCECTYFTSVNQRTCVECPFCVADKSKAA GT:EXON 1|1-180:0| BL:PDB:NREP 1 BL:PDB:REP 56->126|1h5yB|4e-04|26.8|71/253| RP:PDB:NREP 1 RP:PDB:REP 18->172|2avuE|5e-10|20.8|144/156| RP:PFM:NREP 1 RP:PFM:REP 34->172|PF05280|3e-07|37.2|121/168|FlhC| HM:PFM:NREP 1 HM:PFM:REP 29->173|PF05280|2.9e-09|21.6|134/176|FlhC| GO:PFM:NREP 4 GO:PFM GO:0003677|"GO:DNA binding"|PF05280|IPR007944| GO:PFM GO:0016563|"GO:transcription activator activity"|PF05280|IPR007944| GO:PFM GO:0030092|"GO:regulation of flagellum assembly"|PF05280|IPR007944| GO:PFM GO:0045941|"GO:positive regulation of transcription"|PF05280|IPR007944| RP:SCP:NREP 1 RP:SCP:REP 18->172|2avuE1|3e-10|20.8|144/156|e.64.1.1| OP:NHOMO 5 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------2----------------------------------------------------------------1--------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 151 STR:RPRED 83.9 SQ:SECSTR #################HHHHHHTTcccHHHHHHccccHHHHHHHHH##HHcccccccccccccTHHHHccHcHHHHHHHHHHHHHHHHHHTTTcccEEHHHHHHHHHHHETTHHHcccccccccccH##HHHHHHHHHHHTTcEEEEEcTTTccEEEEEcccccccccTTc######## DISOP:02AL 1-5,178-181| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHccccEEEEEEEcccccEEEcccccccccccccEEccccccc //